Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, mouse testis tissue, NIH/3T3 cells, rat testis tissue, MCF-7 cells |
| Positive IHC detected in | human cervical cancer tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 117 publications below |
| IHC | See 46 publications below |
| IF | See 28 publications below |
| CoIP | See 3 publications below |
Product Information
21244-1-AP targets ER in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, bovine, sheep, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15738 Product name: Recombinant human ER protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 65-280 aa of BC128573 Sequence: AAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEV 相同性解析による交差性が予測される生物種 |
| Full Name | estrogen receptor 1 |
| Calculated molecular weight | 595 aa, 66 kDa |
| Observed molecular weight | 65-70 kDa |
| GenBank accession number | BC128573 |
| Gene Symbol | ER |
| Gene ID (NCBI) | 2099 |
| RRID | AB_11042600 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P03372 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
The estrogen receptor (ESR, ER) is a ligand-activated transcription factor composed of several domains important for hormone binding, DNA binding, and activation of transcription. ESR1, also known as ESR or NR3A1, belongs to the nuclear hormone receptor family and NR3 subfamily. It is a nuclear hormone receptor. The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. ESR1 can activate the transcriptional activity of TFF1.[PMID: 11731608,10970861]
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ER antibody 21244-1-AP | Download protocol |
| IHC protocol for ER antibody 21244-1-AP | Download protocol |
| WB protocol for ER antibody 21244-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mol Cell PGC-1α senses the CBC of pre-mRNA to dictate the fate of promoter-proximally paused RNAPII | ||
J Biomed Sci Dioscin promotes osteoblastic proliferation and differentiation via Lrp5 and ER pathway in mouse and human osteoblast-like cell lines. | ||
Theranostics Single-cell analyses reveal evolution mimicry during the specification of breast cancer subtype | ||
J Hazard Mater Cyanidin-3-O-glucoside ameliorates cadmium induced uterine epithelium proliferation in mice. | ||
Free Radic Biol Med Urolithin A protects against domoic acid-induced cognitive deficits via promoting estrogen receptor-α-mediated mitochondrial biogenesis signaling in mice | ||
J Med Chem Discovery of Thiochroman Derivatives as Potent, Oral Selective Estrogen Receptor Degraders and Antagonists for the Treatment of Endocrine-Resistant Breast Cancer |









