Validation Data Gallery
Tested Applications
| Positive WB detected in | Cobalt Chloride treated HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 21 publications below |
| IHC | See 7 publications below |
| IF | See 4 publications below |
| CoIP | See 1 publications below |
| ChIP | See 1 publications below |
Product Information
26422-1-AP targets HIF2α/EPAS1 in WB, IHC, IF, CoIP, ChIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24886 Product name: Recombinant human EPAS1 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 521-870 aa of BC051338 Sequence: FNELDLETLAPYIPMDGEDFQLSPICPEERLLAENPQSTPQHCFSAMTNIFQPLAPVAPHSPFLLDKFQQQLESKKTEPEHRPMSSIFFDAGSKASLPPCCGQASTPLSSMGGRSNTQWPPDPPLHFGPTKWAVGDQRTEFLGAAPLGPPVSPPHVSTFKTRSAKGFGARGPDVLSPAMVALSNKLKLKRQLEYEEQAFQDLSGGDPPGGSTSHLMWKRMKNLRGGSCPLMPDKPLSANVPNDKFTQNPMRGLGHPLRHLPLPQPPSAISPGENSKSRFPPQCYATQYQDYSLSSAHKVSGMASRLLGPSFESYLLPELTRYDCEVNVPVLGSSTLLQGGDLLRALDQAT 相同性解析による交差性が予測される生物種 |
| Full Name | endothelial PAS domain protein 1 |
| Calculated molecular weight | 96 kDa |
| Observed molecular weight | 100-120 kDa |
| GenBank accession number | BC051338 |
| Gene Symbol | HIF2α |
| Gene ID (NCBI) | 2034 |
| RRID | AB_2880510 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q99814 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
HIF2A, also named as EPAS1, is a 870 amino acid protein, which is expressed in most tissues, with highest levels in placenta, lung and heart. HIF2A colocalizes with HIF3A in the nucleus and speckles. HIF2A as a transcription factor involves in the induction of oxygen regulated genes. HIF2A binds to core DNA sequence 5'-[AG]CGTG-3' within the hypoxia response element (HRE) of target gene promoters. HIF2A regulates the vascular endothelial growth factor (VEGF) expression and seems to be implicated in the development of blood vessels and the tubular system of lung. HIF2A may also play a role in the formation of the endothelium that gives rise to the blood brain barrier. The calculated molecular weight of HIF2A is 96 kDa, but In normoxia, HIF2A is probably hydroxylated on Pro-405 and Pro-531 by EGLN1/PHD1, EGLN2/PHD2 and/or EGLN3/PHD3. The hydroxylated prolines promote interaction with VHL, initiating rapid ubiquitination and subsequent proteasomal degradation. Under hypoxia, proline hydroxylation is impaired and ubiquitination is attenuated, resulting in stabilization. The modified HIf2A is about 100-120 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for HIF2α/EPAS1 antibody 26422-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Rep CGG repeats in the human FMR1 gene regulate mRNA localization and cellular stress in developing neurons | ||
J Orthop Translat IHH-GLI-1-HIF-2α signalling influences hypertrophic chondrocytes to exacerbate osteoarthritis progression | ||
Cell Mol Life Sci Iron increases lipid deposition via oxidative stress-mediated mitochondrial dysfunction and the HIF1α-PPARγ pathway. | ||
Int J Gen Med Identification and Validation of Epithelial Cell Centre Regulatory Transcription Factors in the Gastric Cancer Microenvironment | ||
J Ethnopharmacol Proteomic analysis reveals proteins and pathways associated with the effects of Hippophae rhamnoides L. total flavonoids on ameliorating excessive erythropoiesis in high-altitude polycythemia mice |
