Validation Data Gallery
Tested Applications
| Positive WB detected in | human artery tissue |
| Positive IP detected in | human placenta tissue |
| Positive IHC detected in | human lung tissue, human skin cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:5000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 18 publications below |
| IHC | See 2 publications below |
| IF | See 5 publications below |
Product Information
15257-1-AP targets Elastin in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7179 Product name: Recombinant human ELN protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 307-658 aa of BC065566 Sequence: GLVPGGPGFGPGVVGVPGAGVPGVGVPGAGIPVVPGAGIPGAAVPGVVSPEAAAKAAAKAAKYGARPGVGVGGIPTYGVGAGGFPGFGVGVGGIPGVAGVPSVGGVPGVGGVPGVGISPEAQAAAAAKAAKYGLVPGVGVAPGVGVAPGVGVAPGVGLAPGVGVAPGVGVAPGVGVAPGIGPGGVAGAAAGLGAGIPGLGVGVGVPGLGVGAGVPGLGVGAGVPGFRAVPGALAAAKAAKYGAAVPGVLGGLGALGGVGIPGGVVGAGPAAAAAAAKAAAKAAQFGLVGAAGLGGLGVGGLGVPGVGGLGGIPPAAAAKAAKYGVAARPGFGLSPIFPGGACLGKACGRKRK 相同性解析による交差性が予測される生物種 |
| Full Name | elastin |
| Calculated molecular weight | 68 kDa |
| Observed molecular weight | 60-70 kDa |
| GenBank accession number | BC065566 |
| Gene Symbol | Elastin |
| Gene ID (NCBI) | 2006 |
| RRID | AB_2878120 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P15502 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Elastic fibers are an abundant and integral part of many extracellular matrices, in which they provide the elastic properties to tissues such as arterial, lung, and skin. Elastic fibers are consisting of an elastin core surrounded by a mantle of fibrillin-rich microfibrils (PMID: 12082143). Elastin is an extremely durable, insoluble biopolymer formed through the lysine-mediated crosslinking of its soluble precursor tropoelastin, which is an approximately 60-70 kDa protein (PMID: 15837523). Deletions and mutations in the elastin gene (ELN) are associated with supravalvular aortic stenosis (SVAS) and autosomal dominant cutis laxa.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Elastin antibody 15257-1-AP | Download protocol |
| IP protocol for Elastin antibody 15257-1-AP | Download protocol |
| WB protocol for Elastin antibody 15257-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Am J Respir Cell Mol Biol Glutaminolysis Promotes Collagen Translation and Stability via α-ketoglutarate Mediated mTOR Activation and Proline Hydroxylation. | ||
J Med Chem Design, Synthesis, and Biological Evaluation of an Orally Bioavailable, Potent, and Selective ROCK2 Inhibitor for Psoriasis Treatment | ||
Int J Mol Sci αvβ3 Integrin as a Link between the Development of Fibrosis and Thyroid Hormones in Systemic Sclerosis | ||
J Cell Physiol Novel insight into the role of clusterin on intraocular pressure regulation by modifying actin polymerization and extracellular matrix remodeling in the trabecular meshwork. | ||
Am J Physiol Cell Physiol SEMA3B inhibits TGFβ-induced extracellular matrix protein production and its reduced levels are associated with a decline in lung function in IPF | ||
Polymers (Basel) The Development of a 3D PET Fibrous Scaffold Modified with an Umbilical Cord dECM for Liver Tissue Engineering |





