Validation Data Gallery
Tested Applications
Positive WB detected in | A375 cells |
Positive IP detected in | A375 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 7 publications below |
IF | See 2 publications below |
Product Information
10319-1-AP targets EIF3B in WB, IF, IP, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag0386 Product name: Recombinant human EIF3B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 381-562 aa of BC001173 Sequence: FSPCERYLVTFSPLMDTQDDPQAIIIWDILTGHKKRGFHCESSAHWPIFKWSHDGKFFARMTLDTLSIYETPSMGLLDKKSLKISGIKDFSWSPGGNIIAFWVPEDKDIPARVTLMQLPTRQEIRVRNLFNVVDCKLHWQKNGDYLCVKVDRTPKGTQGVVTNFEIFRMREKQVPVDVVEMK 相同性解析による交差性が予測される生物種 |
Full Name | eukaryotic translation initiation factor 3, subunit B |
Calculated molecular weight | 93 kDa |
Observed molecular weight | 115 kDa |
GenBank accession number | BC001173 |
Gene Symbol | EIF3B |
Gene ID (NCBI) | 8662 |
RRID | AB_2096732 |
Conjugate | Unconjugated |
Form | |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P55884 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
EIF3B, also named as Eukaryotic translation initiation factor 3 subunit B, is a 814 amino acid protein, which contains 1 RRM (RNA recognition motif) domain and 8 WD repeats and belongs to the eIF-3 subunit B family. EIF3B as a RNA-binding component of the eukaryotic translation initiation factor 3 (eIF-3) complex, is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression. The calculated molecular weight of EIF3B is 93 kDa, but the phosphorylated EIF3B protein is about 115 kDa.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for EIF3B antibody 10319-1-AP | Download protocol |
IP protocol for EIF3B antibody 10319-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nucleic Acids Res SUMOylation of the m6A-RNA methyltransferase METTL3 modulates its function. | ||
Elife Translation initiation by the hepatitis C virus IRES requires eIF1A and ribosomal complex remodeling. | ||
Cancers (Basel) GDF15 Is an Eribulin Response Biomarker also Required for Survival of DTP Breast Cancer Cells. | ||
bioRxiv Novel gene-specific translation mechanism of dysregulated, chronic inflammation reveals promising, multifaceted COVID-19 therapeutics. | ||
Nat Commun METTL3 acetylation impedes cancer metastasis via fine-tuning its nuclear and cytosolic functions | ||
Cell Chem Biol Non-canonical function of histone methyltransferase G9a in the translational regulation of chronic inflammation |