Validation Data Gallery
Tested Applications
| Positive WB detected in | HEK-293T cells, mouse testis tissue, mouse liver tissue, L02 cells, HeLa cells, PC-3 cells, HepG2 cells, rat liver tissue, Jurkat cells, NIH/3T3 cells, C6 cells |
| Positive IP detected in | mouse liver tissue |
| Positive IHC detected in | human testis tissue, human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells, L02 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 10 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
| CoIP | See 1 publications below |
Product Information
10227-1-AP targets EIF2S2 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0269 Product name: Recombinant human EIF2S2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-210 aa of BC000461 Sequence: MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKDLEADEEDTRKKDASDDLDDLNFFNQKKKKKKTKKIFDIDEAEEGVKDLKIESDVQEPTEPEDDLDIMLGNKKKKKKNVKFPDEDEILEKDEALEDEDNKKDDGISFSNQTGPAWAGSERDYTYEELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVV 相同性解析による交差性が予測される生物種 |
| Full Name | eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa |
| Calculated molecular weight | 38 kDa |
| Observed molecular weight | 50 kDa |
| GenBank accession number | BC000461 |
| Gene Symbol | EIF2S2 |
| Gene ID (NCBI) | 8894 |
| RRID | AB_2262043 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P20042 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Eukaryotic translation initiation factor 2 (eIF2) is composed of three subunits, eIF2 alpha, eIF2 beta (EIF2S2), and eIF2 gamma, which are present in equal molar amounts. eIF2 beta plays a central role in the maintenance of what is generally considered a rate-limiting step in mRNA translation. In the early steps of protein synthesis, eIF2 beta binds GTP and Met-tRNA and transfers Met-tRNA to the 40S ribosomal subunit. At the end of the initiation process, GTP bound to eIF2 beta is hydrolyzed to GDP and the eIF2/GDP complex is released from the ribosome. The exchange of GDP bound to eIF2 beta for GTP is a prerequisite to binding Met-tRNA and is mediated by eIF2 beta, which recycles the eIF2 complex for another round of initiation.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for EIF2S2 antibody 10227-1-AP | Download protocol |
| IHC protocol for EIF2S2 antibody 10227-1-AP | Download protocol |
| IP protocol for EIF2S2 antibody 10227-1-AP | Download protocol |
| WB protocol for EIF2S2 antibody 10227-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cancer Res Comparative oncogenomics identifies PSMB4 and SHMT2 as potential cancer driver genes. | ||
J Transl Med CAPN2 promotes apalutamide resistance in metastatic hormone-sensitive prostate cancer by activating protective autophagy | ||
Front Mol Biosci Comprehensive Characterization of Ageing-Relevant Subtypes Associated With Different Tumorigenesis and Tumor Microenvironment in Prostate Cancer.
| ||
J Med Genet Bi-allelic variants in chromatoid body protein TDRD6 cause spermiogenesis defects and severe oligoasthenoteratozoospermia in humans | ||
Biomol Ther (Seoul) Translation Initiation Factor-2S2 (eIF2S2) Contributes to Cervical Carcinogenesis by Inhibiting the TGF-β/SMAD4 Signaling Pathway | ||
Neurogenetics Genetic ablation of ataxin-2 increases several global translation factors in their transcript abundance but decreases translation rate. |





















