Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, RAW264.7, Jurkat cells, Ramos cells |
| Positive IHC detected in | human ovary tumor tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:5000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
Product Information
22008-1-AP targets EGR1 in WB, IHC, IF-P, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, zebrafish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13395 Product name: Recombinant human EGR1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-363 aa of BC073983 Sequence: MAAAKAEMQLMSPLQISDPFGSFPHSPTMDNYPKLEEMMLLSNGAPQFLGAAGAPEGSGSNSSSSSSGGGGGGGGGSNSSSSSSTFNPQADTGEQPYEHLTAESFPDISLNNEKVLVETSYPSQTTRLPPITYTGRFSLEPAPNSGNTLWPEPLFSLVSGLVSMTNPPASSSSAPSPAASSASASQSPPLSCAVPSNDSSPIYSAAPTFPTPNTDIFPEPQSQAFPGSAGTALQYPPPAYPAAKGGFQVPMIPDYLFPQQQGDLGLGTPDQKPFQGLESRTQQPSLTPLSTIKAFATQSGSQDLKALNTSYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHT 相同性解析による交差性が予測される生物種 |
| Full Name | early growth response 1 |
| Calculated molecular weight | 543 aa, 58 kDa |
| Observed molecular weight | 70-80 kDa |
| GenBank accession number | BC073983 |
| Gene Symbol | EGR1 |
| Gene ID (NCBI) | 1958 |
| RRID | AB_11182923 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P18146 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
EGR1, also named as Early growth response protein 1, is a 543 amino acid protein, which belongs to the EGR C2H2-type zinc-finger protein family. EGR1 as a transcriptional regulator recognizes and binds to the DNA sequence 5'-GCG(T/G)GGGCG-3'(EGR-site) in the promoter region of target genes and binds double-stranded target DNA, irrespective of the cytosine methylation status. EGR1 regulates the transcription of numerous target genes, and thereby plays an important role in regulating the response to growth factors, DNA damage, and ischemia. EGR1 activates expression of p53/TP53 and TGFB1, and thereby helps prevent tumor formation and plays a role in the regulation of cell survival, proliferation and cell death. Egr1 is suggested to be a 55-kDa protein according to the translation of its coding sequence. Analysis of cytoplasmic and nuclear fractions of normal and irradiated native CNS tissue by Western blotting revealed a 110-kDa band for Egr1 localized in the cytoplasm and a 75-kDa version for the nuclear Egr1(PMID: 17497096).
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun Brown adipose tissue secretes OLFM4 to coordinate sensory and sympathetic innervation via Schwann cells | ||
Nat Commun Paclitaxel drives TREM2(+) macrophage expansion underlying its inferior therapeutic efficacy compared to Nab-paclitaxel. | ||
ACS Nano Biomimetic Construction of Degradable DNAzyme-Loaded Nanocapsules for Self-Sufficient Gene Therapy of Pulmonary Metastatic Breast Cancer | ||
J Nanobiotechnology Intervening in hnRNPA2B1-mediated exosomal transfer of tumor-suppressive miR-184-3p for tumor microenvironment regulation and cancer therapy | ||
Adv Sci (Weinh) KLK1 as an Epithelial-Specific Brake Inhibits Colorectal Tumorigenesis by Suppressing B1R-Mediated Fibroblast Phenotypic Transition |