Validation Data Gallery
Tested Applications
| Positive WB detected in | human brain tissue, human heart tissue, Sp2/0 cells |
| Positive IP detected in | mouse skeletal muscle tissue |
| Positive IHC detected in | human pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse testis tissue |
| Positive IF/ICC detected in | SH-SY5Y cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:300-1:600 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 7 publications below |
| IHC | See 3 publications below |
| IF | See 4 publications below |
Product Information
11954-1-AP targets DYNLT1 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2557 Product name: Recombinant human DYNLT1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-113 aa of BC029412 Sequence: MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI 相同性解析による交差性が予測される生物種 |
| Full Name | dynein, light chain, Tctex-type 1 |
| Calculated molecular weight | 113 aa, 12 kDa |
| Observed molecular weight | 12 kDa |
| GenBank accession number | BC029412 |
| Gene Symbol | DYNLT1 |
| Gene ID (NCBI) | 6993 |
| RRID | AB_2230661 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P63172 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
DYNLT (or Tctex-1) was originally described as a light chain component of the dynein motor complex. Tctex-1 also has several dynein-independent functions, including roles in G protein signaling activation and neuronal growth. Tctex-1 is selectively enriched in proliferating neural progenitors of both embryonic and adult brains. Genetic knockdown of Tctex-1 in radial precursors promoted neurogenesis, indicating its implication in regulation of cortical neurogenesis. (Pubmed: 19448628)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for DYNLT1 antibody 11954-1-AP | Download protocol |
| IHC protocol for DYNLT1 antibody 11954-1-AP | Download protocol |
| IP protocol for DYNLT1 antibody 11954-1-AP | Download protocol |
| WB protocol for DYNLT1 antibody 11954-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nanomicro Lett Molecular Mechanisms of Intracellular Delivery of Nanoparticles Monitored by an Enzyme-Induced Proximity Labeling | ||
Nat Neurosci Lfc and Tctex-1 regulate the genesis of neurons from cortical precursor cells.
| ||
Cell Res Dlic1 deficiency impairs ciliogenesis of photoreceptors by destabilizing dynein. | ||
J Cell Biol Ndel1 suppresses ciliogenesis in proliferating cells by regulating the trichoplein-Aurora A pathway.
| ||
Cancers (Basel) Dynein Light Chain Protein Tctex1: A Novel Prognostic Marker and Molecular Mediator in Glioblastoma. | ||
Biochem Pharmacol Cannabinoid receptor-2 expression modulates Gβ1γ2 protein interaction with the activator of G protein signalling 2/dynein light chain protein Tctex-1. |








