Recombinant human DYNC1LI1 protein
Source
e coli.-derived, PET28a
Tag
6*His
Format
Liquid
Cat no : Ag19902
Synonyms
DNCLI1; FLJ10219
Validation Data Gallery View All
Product Information
| Peptide Sequence |
SVVREHVDKLKIPPEEMKQMEQKLIRDFQEYVEPGEDFPASPQRRNTASQEDKDDSVVLPLGADTLT
(167-233aa encoded by BC131620) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |

