Validation Data Gallery
Tested Applications
| Positive WB detected in | HEK-293 cells, MCF-7 cells, mouse cerebellum tissue, NIH/3T3 cells, MDA-MB-231 cells, PANC-1 cells, PC-3 cells, Raji cells, HEK-293T cells |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human breast cancer tissue, human prostate cancer tissue, mouse colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 14 publications below |
| IHC | See 3 publications below |
| IF | See 1 publications below |
| IP | See 1 publications below |
| ChIP | See 1 publications below |
Product Information
27384-1-AP targets DVL1 in WB, IHC, IF/ICC, IP, ChIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26055 Product name: Recombinant human DVL1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 283-416 aa of BC050454 Sequence: LGQGYPYQYPGPPPCFPPAYQDPGFSYGSGSTGSQQSEGSKSSGSTRSSRRAPGREKERRAAGAGGSGSESDHTAPSGVGSSWRERPAGQLSRGSSPRSQASATAPGLPPPHPTTKAYTVVGGPPGGPPVRELA 相同性解析による交差性が予測される生物種 |
| Full Name | dishevelled, dsh homolog 1 (Drosophila) |
| Calculated molecular weight | 75 kDa |
| Observed molecular weight | 73-75 kDa |
| GenBank accession number | BC050454 |
| Gene Symbol | DVL1 |
| Gene ID (NCBI) | 1855 |
| RRID | AB_2880859 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O14640 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
DVL1 is one of three DVL homologous proteins (DVL1-3) widely expressed in embryonic development and in the adult central nervous system. Dishevelled proteins are a necessary component of the Wnt and planar cell polarity developmental signaling pathways. Overexpression of DVL1 has been linked to prostate and breast cancers through the Wnt signaling pathway.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for DVL1 antibody 27384-1-AP | Download protocol |
| IHC protocol for DVL1 antibody 27384-1-AP | Download protocol |
| IP protocol for DVL1 antibody 27384-1-AP | Download protocol |
| WB protocol for DVL1 antibody 27384-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Theranostics Transcription factor AP-4 promotes tumorigenic capability and activates the Wnt/β-catenin pathway in hepatocellular carcinoma. | ||
Genes Dis Naked cuticle homolog 2 controls the differentiation of osteoblasts and osteoclasts and ameliorates bone loss in ovariectomized mice | ||
Exp Cell Res HECW1 restrains cervical cancer cell growth by promoting DVL1 ubiquitination and downregulating the activation of Wnt/β-catenin signaling | ||
Brain Res Bull Excess folic acid supplementation before and during pregnancy and lactation activates β-catenin in the brain of male mouse offspring. | ||
Neural Plast Lycopene-Loaded Microemulsion Regulates Neurogenesis in Rats with Aβ-Induced Alzheimer's Disease Rats Based on the Wnt/β-catenin Pathway. | ||
Biol Trace Elem Res Selenium Deficiency Leads to Changes in Renal Fibrosis Marker Proteins and Wnt/β-Catenin Signaling Pathway Components. |













