Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, K-562 cells, MCF-7 cells, Jurkat cells |
| Positive IP detected in | K-562 cells |
| Positive IHC detected in | mouse brain tissue, human breast cancer tissue, mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 28 publications below |
| IHC | See 6 publications below |
| IF | See 6 publications below |
| CoIP | See 2 publications below |
| ChIP | See 2 publications below |
Product Information
26971-1-AP targets DNMT3B in WB, IHC, IF, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25117 Product name: Recombinant human DNMT3B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-100 aa of NM_001207055 Sequence: MKGDTRHLNGEEDAGGREDSILVNGACSDQSSDSPPILEAIRTPEIRGRRSSSRLSKREVSSLLSYTQDLTGDGDGEDGDGSDTPVMPKLFRETRTRSES 相同性解析による交差性が予測される生物種 |
| Full Name | DNA (cytosine-5-)-methyltransferase 3 beta |
| Calculated molecular weight | 95 kDa |
| Observed molecular weight | 85-96 kDa |
| GenBank accession number | NM_001207055 |
| Gene Symbol | DNMT3B |
| Gene ID (NCBI) | 1789 |
| RRID | AB_2880705 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UBC3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
DNMT3B is a DNA-(cytosine C5)-methyltransferase that is responsible for establishing the methylation patterns in cooperation with DNMT3A through the de novo methylation pathway. It is essential for the establishment of DNA methylation patterns during development. DNMT3B contains a C-terminal catalytic domain and an N-terminal regulatory domain, which are involved in targeting chromatin to regulate its function (PMID: 31547729). DNMT3B has 8 isoforms with the molecular mass of 80-96 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for DNMT3B antibody 26971-1-AP | Download protocol |
| IP protocol for DNMT3B antibody 26971-1-AP | Download protocol |
| WB protocol for DNMT3B antibody 26971-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Protein Cell The chemical reprogramming of unipotent adult germ cells towards authentic pluripotency and de novo establishment of imprinting | ||
Front Cell Dev Biol miR-29b-3p Increases Radiosensitivity in Stemness Cancer Cells via Modulating Oncogenes Axis | ||
Andrology Methylation of eNOS in the rat penile corpus cavernosum under different pathological states and its relationship with erectile function | ||
Brain Sci Neuroprotective Effect of Piracetam against Cocaine-Induced Neuro Epigenetic Modification of DNA Methylation in Astrocytes. | ||
Biol Res DNMT1-mediated PPARα methylation aggravates damage of retinal tissues in diabetic retinopathy mice. | ||
Integr Cancer Ther Huaier Inhibits Proliferation, Migration, and Invasion of Cutaneous Squamous Cell Carcinoma Cells by Inhibiting the Methylation Levels of CDKN2A and TP53. |








