Validation Data Gallery
Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, HepG2 cells, mouse testis tissue, rat testis tissue |
| Positive IP detected in | HepG2 cells |
| Positive IHC detected in | mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 15 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
Product Information
10434-1-AP targets Smac/DIABLO in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, hamster |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0696 Product name: Recombinant human DIABLO protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-239 aa of BC011909 Sequence: MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED 相同性解析による交差性が予測される生物種 |
| Full Name | diablo homolog (Drosophila) |
| Calculated molecular weight | 27 kDa |
| Observed molecular weight | 20 kDa |
| GenBank accession number | BC011909 |
| Gene Symbol | DIABLO |
| Gene ID (NCBI) | 56616 |
| RRID | AB_2092647 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NR28 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Smac/DIABLO is a mitochondrial protein that promotes apoptosis by neutralizing members of the IAP family. SMAC/DIABLO is ubiquitously expressed in normal tissues, and the expression of SMAC messenger RNA (mRNA) in adult testis is the highest .Smac/DIABLO encodes a 239 amino acid protein (~27 kDa). The first 55 amino acids are a mitochondrial targeting signal peptide that is cleaved to generate mature Smac-DIABLO (~21 kDa). When released from mitochondria, Smac-DIABLO acts as a natural antagonist of inhibitor of apoptosis proteins (IAPs). Smac-DIABLO antagonistic activity is based on its N-terminal tetrapeptide (AVPI) that binds baculoviral IAP repeat (BIR) domains of IAPs, releasing their inhibitory effects on both initiator and effector caspases, thus promoting cell death. (PMID: 32325691, PMID: 32575872,PMID: 25650938)
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Smac/DIABLO antibody 10434-1-AP | Download protocol |
| IF protocol for Smac/DIABLO antibody 10434-1-AP | Download protocol |
| IHC protocol for Smac/DIABLO antibody 10434-1-AP | Download protocol |
| IP protocol for Smac/DIABLO antibody 10434-1-AP | Download protocol |
| WB protocol for Smac/DIABLO antibody 10434-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Eur J Med Chem PKM2/PDK1 dual-targeted shikonin derivatives restore the sensitivity of EGFR-mutated NSCLC cells to gefitinib by remodeling glucose metabolism | ||
J Cell Physiol Resveratrol ameliorates podocyte damage in diabetic mice via SIRT1/PGC-1α mediated attenuation of mitochondrial oxidative stress. | ||
Ann Transl Med Botrychium schaffneri Underw. extract acts via DIABLO to induce apoptosis and inhibit proliferation of non-small cell lung carcinoma in vitro and in vivo. | ||
Chin Med Shikonin and 4-hydroxytamoxifen synergistically inhibit the proliferation of breast cancer cells through activating apoptosis signaling pathway in vitro and in vivo. | ||
Acta Biochim Biophys Sin (Shanghai) Cathelicidin PR-39 peptide inhibits hypoxia/reperfusion-induced kidney cell apoptosis by suppression of the endoplasmic reticulum-stress pathway. | ||
Mol Med Rep Mechanisms underlying the protective effect of tannic acid against arsenic trioxide‑induced cardiotoxicity in rats: Potential involvement of mitochondrial apoptosis. |
