Validation Data Gallery
Tested Applications
| Positive WB detected in | NCI-H1299 cells, A431 cells, HSC-T6 cells, HeLa cells, HEK-293 cell, HepG2 cells, HT-29 cells, NIH/3T3 cells, 4T1 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 8 publications below |
| IF | See 2 publications below |
| IP | See 3 publications below |
| CoIP | See 2 publications below |
Product Information
67025-1-Ig targets DDX5 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, pig, bovine |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24821 Product name: Recombinant human DDX5 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 434-614 aa of NM_004396 Sequence: RSTKTGTAYTFFTPNNIKQVSDLISVLREANQAINPKLLQLVEDRGSGRSRGRGGMKDDRRDRYSAGKRGGFNTFRDRENYDRGYSSLLKRDFGAKTQNGVYSAANYTNGSFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAYAYPATAAAPMIGYPMPTGYSQ 相同性解析による交差性が予測される生物種 |
| Full Name | DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 |
| Observed molecular weight | 69 kDa |
| GenBank accession number | NM_004396 |
| Gene Symbol | DDX5 |
| Gene ID (NCBI) | 1655 |
| RRID | AB_2882340 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P17844 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
DDX5 or p68, a member of DEAD/H BOX, which has a characteristic DEAD box, is a proliferation-associated nuclear antigen. DDX5 involves in the alternative regulation of pre-mRNA splicing, act as a RNA helicase to increase tau exon10 inclusion in a RBM4-dependent manner. It's also a transcription coactivator for extrogen receptor ESR1 and androgen receptor AR. Once synergized with DDX17 and SRA1 RNA, DDX5 activated MYOD1 transcription activity and involved in skeletal muscle differentiation.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for DDX5 antibody 67025-1-Ig | Download protocol |
| IHC protocol for DDX5 antibody 67025-1-Ig | Download protocol |
| IP protocol for DDX5 antibody 67025-1-Ig | Download protocol |
| WB protocol for DDX5 antibody 67025-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Theranostics LncRNA PRADX-mediated recruitment of PRC2/DDX5 complex suppresses UBXN1 expression and activates NF-κB activity, promoting tumorigenesis. | ||
Cancer Biol Ther VAMP8 suppresses the metastasis via DDX5/β-catenin signal pathway in osteosarcoma | ||
bioRxiv Maf-family bZIP transcription factor NRL interacts with RNA-binding proteins and R-loops in retinal photoreceptors | ||
Virol J DEAD box RNA helicase 5 is a new pro-viral host factor for Sindbis virus infection | ||
Adv Sci (Weinh) Glutamine Deprivation Triggers Tribbles Homolog 3 Dependent G-Quadruplex Resolution to Maintain DNA Repair and Tumor Survival. | ||
Antiviral Res Poly (allylamine hydrochloride)-selenium nanoparticles inhibit porcine reproductive and respiratory syndrome virus by targeting DDX5 and reactive oxygen species.
|







