Validation Data Gallery
Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, HepG2 cells, Jurkat cells |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 6 publications below |
| IHC | See 1 publications below |
| IF | See 2 publications below |
| IP | See 1 publications below |
Product Information
11723-1-AP targets DDX39A in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, chicken |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2311 Product name: Recombinant human DDX39 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-322 aa of BC032128 Sequence: MAEQDVENDLLDYDEEEEPQAPQESTPAPPKKDIKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQIEPVNGQVTVLVMCHTRELAFQISKEYERFSKYMPSVKVSVFFGGLSIKKDEEVLKKNCPHVVVGTPGRILALVRNRSFSLKNVKHFVLDECDKMLEQLDMRRDVQEIFRLTPHEKQCMMFSATLSKDIRPVCRKFMQDPMEVFVDDETKLTLHGLQQYYVKLKDSEKNRKLFDLLDVLEFNQPVTLSAVQGFPAADPGGHQSVWPGDGHRASQHRL 相同性解析による交差性が予測される生物種 |
| Full Name | DEAD (Asp-Glu-Ala-Asp) box polypeptide 39 |
| Calculated molecular weight | 427 aa, 49 kDa |
| Observed molecular weight | 49-55 kDa |
| GenBank accession number | BC032128 |
| Gene Symbol | DDX39 |
| Gene ID (NCBI) | 10212 |
| RRID | AB_10858318 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O00148 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
DDX39A, also named the BAT1 protein, contains the nine conserved motifs that characterize the DEAD-box family of RNA-binding proteins. The family includes proteins found in all eukaryotic cell types, with considerable divergence in the sequences lying between the conserved motifs. Some of the motifs were known before the definition of the family and are responsible for binding to mRNA or ATP, or possess ATPase activity. Phylogenetic analyses have grouped BAT1 with the defining member of the DEAD-box family, eIF-4. This is a translation initiation factor required for the dissociation of stem/loop structures in mRNA at the ribosomes. This antibody may cross-react with DDX39B.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for DDX39A antibody 11723-1-AP | Download protocol |
| IHC protocol for DDX39A antibody 11723-1-AP | Download protocol |
| IP protocol for DDX39A antibody 11723-1-AP | Download protocol |
| WB protocol for DDX39A antibody 11723-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nucleic Acids Res A novel all-in-one conditional knockout system uncovered an essential role of DDX1 in ribosomal RNA processing. | ||
Int J Biol Sci DDX39 as a predictor of clinical prognosis and immune checkpoint therapy efficacy in patients with clear cell renal cell carcinoma. | ||
Cell Rep Proteomics reveal cap-dependent translation inhibitors remodel the translation machinery and translatome. | ||
J Transl Med A novel peptide encoded by circSRCAP confers resistance to enzalutamide by inhibiting the ubiquitin-dependent degradation of AR-V7 in castration-resistant prostate cancer | ||
Nucleic Acids Res Parsing the roles of DExD-box proteins DDX39A and DDX39B in alternative RNA splicing | ||
Mol Cell 1The RNA helicase DDX39A binds a conserved structure in chikungunya virus RNA to control infection
|



