Validation Data Gallery
Tested Applications
| Positive WB detected in | HEK-293T cells, Jurkat cells, mouse testis tissue, HeLa cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human breast cancer tissue, human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells, Hela cells |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 7 publications below |
| IHC | See 5 publications below |
| IF | See 2 publications below |
| IP | See 1 publications below |
Product Information
11324-1-AP targets DDX20 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1863 Product name: Recombinant human DDX20 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 520-824 aa of BC011556 Sequence: SHSECGIIEKATSPKELGCDRQSEEQMKNSVQTPVENSTNSQHQVKEALPVSLPQIPCLSSFKIHQPYTLTFAELVEDYEHYIKEGLEKPVEIIRHYTGPGDQTVNPQNGFVRNKVTEQRVPVLASSSQSGDSESDSDSYSSRTSSQSKGNKSYLEGSSDNQLKDSESTPVDDRISLEQPPNGSDTPNPEKYQESPGIQMKTRLKEGASQRAKQSRRNLPRRSSFRLQTEAQEDDWYDCHREIRLSFSDTYQDYEEYWRAYYRAWQEYYAAASHSYYWNAQRHPSWMAAYHMNTIYLQEMMHSNQ 相同性解析による交差性が予測される生物種 |
| Full Name | DEAD (Asp-Glu-Ala-Asp) box polypeptide 20 |
| Calculated molecular weight | 824 aa, 92 kDa |
| Observed molecular weight | 100 kDa |
| GenBank accession number | BC011556 |
| Gene Symbol | DDX20 |
| Gene ID (NCBI) | 11218 |
| RRID | AB_2092401 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UHI6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
DEAD (Asp-Glu-Ala-Asp) box polypeptide 20 (DDX20), also known as DP103 or Gemin3, is a member of the DEAD box protein family expressed ubiquitously. DEAD family proteins use energy from ATP hydrolysis for RNA chaperoning and RNPase activity (PMID: 27121695). As a core member of the survival motor neuron (SMN) complex, DDX20 participate in small nuclear ribonucleoprotein (snRNP) biogenesis. Second, DDX20 have direct roles in gene expression in view of its implication in transcription and post-transcriptional gene silencing. Addition, the false expression of DDX20 could have deleterious effects on cellular homeostasis thus leading to cancer development and progression (PMID:29523774). Anymore, DDX20 could be identified as a biomarker and metastasis-driving oncogene of human breast cancer (PMID: 25083991). The detected weight of DDX20 is slightly higher than the theoretical molecular weight that is because of phosphorylation after translation.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for DDX20 antibody 11324-1-AP | Download protocol |
| IF protocol for DDX20 antibody 11324-1-AP | Download protocol |
| IHC protocol for DDX20 antibody 11324-1-AP | Download protocol |
| IP protocol for DDX20 antibody 11324-1-AP | Download protocol |
| WB protocol for DDX20 antibody 11324-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Clin Invest DEAD-box helicase DP103 defines metastatic potential of human breast cancers.
| ||
Dev Cell DDX20 is required for cell-cycle reentry of prospermatogonia and establishment of spermatogonial stem cell pool during testicular development in mice | ||
Aging (Albany NY) An artificial neural network model to diagnose non-obstructive azoospermia based on RNA-binding protein-related genes | ||
Comput Struct Biotechnol J Analysis of the expression, function, prognosis and co-expression genes of DDX20 in gastric cancer. | ||
Arthritis Res Ther Integrating transcriptome-wide study and mRNA expression profiles yields novel insights into the biological mechanism of chondropathies. | ||
Biosci Rep FOXL2 Down-regulates Vitellogenin Expression at Mature Stage in Eriocheir sinensis. |









