Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse brain tissue, HEK-293T cells, HEK-293 cells, rat brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 4 publications below |
| WB | See 14 publications below |
| IHC | See 2 publications below |
| IF | See 5 publications below |
| IP | See 7 publications below |
| CoIP | See 2 publications below |
| ChIP | See 4 publications below |
Product Information
19910-1-AP targets DDX17 in WB, IHC, IF/ICC, IP, CoIP, chIP, ELISA, PLA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13723 Product name: Recombinant human DDX17,P72 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 381-729 aa of BC000595 Sequence: NLELSANHNILQIVDVCMESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLEEANQAINPKLMQLVDHRGGGGGGGGRSRYRTTSSANNPNLMYQDECDRRLRGVKDGGRRDSASYRDRSETDRAGYANGSGYGSPNSAFGAQAGQYTYGQGTYGAAAYGTSSYTAQEYGAGTYGASSTTSTGRSSQSSSQQFSGIGRSGQQPQPLMSQQFAQPPGATNMIGYMGQTAYQYPPPPPPPPPSRK 相同性解析による交差性が予測される生物種 |
| Full Name | DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 |
| Calculated molecular weight | 729 aa, 80 kDa |
| Observed molecular weight | 72-80 kDa |
| GenBank accession number | BC000595 |
| Gene Symbol | DDX17 |
| Gene ID (NCBI) | 10521 |
| RRID | AB_10667004 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q92841 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
DDX17, also named as DEAD box protein p72 and DEAD box protein p82, is a 729 amino acid protein, which belongs to the DEAD box helicase family. DDX5/DBP2 subfamily. DDX17 is widely expressed. Levels tend to increase during colon cancer progression, from very low in benign hyperplastic polyps to very high in tubular and villous adenomas. DDX17 as an RNA helicase unwinds RNA and alters RNA structures through ATP binding and hydrolysis. DDX17 is involved in multiple cellular processes, including pre-mRNA splicing, alternative splicing, ribosomal RNA processing and miRNA processing, as well as transcription regulation. It Regulates the alternative splicing of exons exhibiting specific features. identification and characterisation of p72, a novel human nuclear DEAD box protein, which shows a striking homology to p68. This antibody could detect the 72 kDa isoform and 80 kDa isoform of DDX17.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for DDX17 antibody 19910-1-AP | Download protocol |
| IHC protocol for DDX17 antibody 19910-1-AP | Download protocol |
| IP protocol for DDX17 antibody 19910-1-AP | Download protocol |
| WB protocol for DDX17 antibody 19910-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mol Cell Circadian PERIOD proteins regulate TC-DSB repair through anchoring to the nuclear envelope
| ||
Nat Commun Intragenic recruitment of NF-κB drives splicing modifications upon activation by the oncogene Tax of HTLV-1. | ||
Nucleic Acids Res The RNA helicase DDX17 controls the transcriptional activity of REST and the expression of proneural microRNAs in neuronal differentiation. | ||
Nucleic Acids Res RNA helicase-dependent gene looping impacts messenger RNA processing
| ||
Clin Transl Med DEAD-Box Helicase 17 exacerbates non-alcoholic steatohepatitis via transcriptional repression of cyp2c29, inducing hepatic lipid metabolism disorder and eliciting the activation of M1 macrophages | ||
PLoS Pathog Hepatitis B virus Core protein nuclear interactome identifies SRSF10 as a host RNA-binding protein restricting HBV RNA production. |









