Recombinant human DCD protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag2613
Synonyms
AIDD; DCD-1; DSEP; HCAP; MGC71930; PIF
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MRFMTLLFLTALAGALVCAYDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL
(1-110 aa encoded by BC062682) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |

