Validation Data Gallery
Tested Applications
| Positive WB detected in | LNCaP cells, A549 cells, HeLa cells, HepG2 cells, K-562 cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells, 4T1 cells |
| Positive IHC detected in | human breast cancer tissue, human placenta tissue, human stomach cancer tissue, mouse skin tissue, mouse small intestine tissue, rat small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human breast cancer tissue |
| Positive IF/ICC detected in | HCT 116 cells, HT-1376 cells |
| Positive FC (Intra) detected in | HCT 116 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
| IF | See 1 publications below |
| CoIP | See 1 publications below |
Product Information
67815-1-Ig targets DAPK1 in WB, IHC, IF/ICC, IF-P, FC (Intra), CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29838 Product name: Recombinant human DAPK1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 638-798 aa of BC113660 Sequence: ALTTDGKTAEDLARSEQHEHVAGLLARLRKDTHRGLFIQQLRPTQNLQPRIKLKLFGHSGSGKTTLVESLKCGLLRSFFRRRRPRLSSTNSSRFPPSPLASKPTVSVSINNLYPGCENVSVRSRSMMFEPGLTKGMLEVFVAPTHHPHCSADDQSTKAIDI 相同性解析による交差性が予測される生物種 |
| Full Name | death-associated protein kinase 1 |
| Calculated molecular weight | 1430 aa, 160 kDa |
| Observed molecular weight | 160 kDa |
| GenBank accession number | BC113660 |
| Gene Symbol | DAPK1 |
| Gene ID (NCBI) | 1612 |
| RRID | AB_2918578 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P53355 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
DAPK1(Death-associated protein kinase 1) is a stress-activated tumor suppressor protein that plays a role in both proapoptotic or antiapoptotic signal transduction pathways. Loss of DAPK1 expression is associated with a selective advantage fortumor cells to resist apoptotic stimuli, allowing them to separate from the original tumor; from this point of view, DAPK1 could be considered a tumor metastases inhibitor gene(PMID:17319784).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for DAPK1 antibody 67815-1-Ig | Download protocol |
| IF protocol for DAPK1 antibody 67815-1-Ig | Download protocol |
| IHC protocol for DAPK1 antibody 67815-1-Ig | Download protocol |
| WB protocol for DAPK1 antibody 67815-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Theranostics Macrophage membrane‒biomimetic nanoparticles target inflammatory microenvironment for epilepsy treatment | ||
Cell Commun Signal P38-DAPK1 axis regulated LC3-associated phagocytosis (LAP) of microglia in an in vitro subarachnoid hemorrhage model | ||
Adv Sci (Weinh) Epigenetic Regulation of DAPK1 and Netrin-1 Drives Diabetic Encephalopathy | ||
Chin J Nat Med Morin enhances the renoprotective effects of Empagliflozin in diabetic kidney disease via targeting ATF6-DAPK1 signaling. | ||
Biochem Biophys Res Commun KLHL20 alleviates high glucose-induced mitochondrial apoptosis in renal tubular cells by targeting DAPK1 for ubiquitination and degradation. |











