Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, human heart tissue, human skeletal muscle tissue, rat skeletal muscle tissue, mouse skeletal muscle tissue, HEK-293 cells, HepG2 cells, MCF-7 cells, Jurkat cells, HSC-T6 cells, ROS1728 cells, RAW 264.7 cells |
| Positive IHC detected in | human liver cancer tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:5000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 122 publications below |
| IHC | See 3 publications below |
| IF | See 17 publications below |
Product Information
66264-1-Ig targets Cytochrome c in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, canine |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24349 Product name: Recombinant human Cytochrome c protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-105 aa of BC009578 Sequence: MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE 相同性解析による交差性が予測される生物種 |
| Full Name | cytochrome c, somatic |
| Calculated molecular weight | 12 kDa |
| Observed molecular weight | 12-15 kDa |
| GenBank accession number | BC009578 |
| Gene Symbol | Cytochrome c |
| Gene ID (NCBI) | 54205 |
| RRID | AB_2716798 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P99999 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Cytochrome c is a 12-15 kDa electron transporting protein located in the inner mitochondrial membrane. Upon apoptotic stimulation, cytochrome c can be released from mitochondria into cytoplasm, resulting in caspase-3 activation and apoptosis. Measurement of cytochrome c release from the mitochondria is useful for detection of the onset of apoptosis in cells. In addition, cytochrome c can also leave cells and be detectable in extra-cellular medium of apoptotic cells and serum of cancer patients. The level of serum cytochrome c may serve as a prognostic maker during cancer therapy.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Cytochrome c antibody 66264-1-Ig | Download protocol |
| IHC protocol for Cytochrome c antibody 66264-1-Ig | Download protocol |
| WB protocol for Cytochrome c antibody 66264-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Hepatology Hepatic stimulator substance resists hepatic ischemia/reperfusion injury by regulating Drp1 translocation and activation. | ||
Cell Death Differ ZNF451 collaborates with RNF8 to regulate RNF168 localization and amplify ubiquitination signaling to promote DNA damage repair and regulate radiosensitivity | ||
Nat Commun Endonuclease G promotes autophagy by suppressing mTOR signaling and activating the DNA damage response. | ||
Redox Biol Mecheliolide elicits ROS-mediated ERS driven immunogenic cell death in hepatocellular carcinoma. | ||
ACS Appl Mater Interfaces Extracellular Matrix-Mimicking Hydrogel with Angiogenic and Immunomodulatory Properties Accelerates Healing of Diabetic Wounds by Promoting Autophagy | ||
J. Pineal Res. Human transporters, PEPT1/2, facilitate melatonin transportation into mitochondria of cancer cells: an implication of the therapeutic potential. |
