Validation Data Gallery
Tested Applications
| Positive WB detected in | HT-29 cells, HeLa cells, Jurkat cells, K-562 cells, C6 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human skin cancer tissue, human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells, HT-29 cells |
| Positive FC (Intra) detected in | Ramos cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 93 publications below |
| IHC | See 8 publications below |
| IF | See 4 publications below |
Product Information
28603-1-AP targets Cyclin B1 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, rat samples.
| Tested Reactivity | human, rat |
| Cited Reactivity | human, mouse, rat, pig, canine, chicken, bovine, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29426 Product name: Recombinant human CCNB1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-140 aa of BC006510 Sequence: MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEE 相同性解析による交差性が予測される生物種 |
| Full Name | cyclin B1 |
| Calculated molecular weight | 48 kDa |
| Observed molecular weight | 55-60 kDa |
| GenBank accession number | BC006510 |
| Gene Symbol | Cyclin B1 |
| Gene ID (NCBI) | 891 |
| RRID | AB_2881179 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P14635 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Cyclin B1 is a regulatory protein involved in mitosis. The gene product complexes with p34(cdc2) to form the maturation-promoting factor (MPF). Two alternative transcripts have been found, a constitutively expressed transcript and a cell cycle-regulated transcript, that is expressed predominantly during G2/M phase of the cell cycle. The different transcripts result from the use of alternate transcription initiation sites. The antibody is specific to CCNB1. We got a 55-60 kDa band in western blotting maybe due to phosphorylation.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Cyclin B1 antibody 28603-1-AP | Download protocol |
| IF protocol for Cyclin B1 antibody 28603-1-AP | Download protocol |
| IHC protocol for Cyclin B1 antibody 28603-1-AP | Download protocol |
| IP protocol for Cyclin B1 antibody 28603-1-AP | Download protocol |
| WB protocol for Cyclin B1 antibody 28603-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Cell Biol O-GlcNAcylation determines the translational regulation and phase separation of YTHDF proteins | ||
Acta Pharm Sin B Design, synthesis, and antitumor activity of novel thioheterocyclic nucleoside derivatives by suppressing the c-MYC pathway | ||
Clin Transl Med Artemisitene suppresses rheumatoid arthritis progression via modulating METTL3‐mediated N6‐methyladenosine modification of ICAM2 mRNA in fibroblast‐like synoviocytes | ||
Cancer Lett Trim21-mediated HIF-1α degradation attenuates aerobic glycolysis to inhibit renal cancer tumorigenesis and metastasis. | ||
Mol Oncol Interaction between membranous EBP50 and myosin 9 as a favorable prognostic factor in ovarian clear cell carcinoma | ||
Life Sci Periplocin inhibits hepatocellular carcinoma progression and reduces the recruitment of MDSCs through AKT/NF-κB pathway |











