Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, SK-N-SH cells |
| Positive IHC detected in | Hepatocellular carcinoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 4 publications below |
| IHC | See 4 publications below |
Product Information
30850-1-AP targets COL4A1 in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag34391 Product name: Recombinant human COL4A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 901-1110 aa of BC151220 Sequence: LPGEKGDHGFPGSSGPRGDPGLKGDKGDVGLPGKPGSMDKVDMGSMKGQKGDQGEKGQIGPIGEKGSRGDPGTPGVPGKDGQAGQPGQPGPKGDPGISGTPGAPGLPGPKGSVGGMGLPGTPGEKGVPGIPGPQGSPGLPGDKGAKGEKGQAGPPGIGIPGLRGEKGDQGIAGFPGSPGEKGEKGSIGIPGMPGSPGLKGSPGSVGYPGS 相同性解析による交差性が予測される生物種 |
| Full Name | collagen, type IV, alpha 1 |
| Calculated molecular weight | 1669 aa, 161 kDa |
| Observed molecular weight | 160-220 kDa |
| GenBank accession number | BC151220 |
| Gene Symbol | COL4A1 |
| Gene ID (NCBI) | 1282 |
| RRID | AB_3742377 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | P02462 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
COL4A1 (Collagen Type IV Alpha 1 Chain) encodes a major component of type IV collagen, which is an essential structural element of basement membranes in various tissues. COL4A1 forms heterotrimers with other collagen type IV chains (e.g., COL4A2) and interacts with extracellular matrix components such as laminins, proteoglycans, and perlecans. Proteolytic cleavage of the non-collagenous domain of COL4A1 produces a fragment called arresten, which has anti-angiogenic and tumor suppressor properties. Elevated expression of COL4A1 has been observed in various cancers, including hepatocellular carcinoma (HCC), where it promotes tumor growth and metastasis through the FAK-Src signaling pathway. COL4A1 is highly expressed in various tissues, including the placenta, fat, and other organs. The expression of COL4A1 can be regulated by transcription factors such as RUNX1, which has been shown to upregulate COL4A1 in hepatocellular carcinoma. The molecular weight of OSBPL5 is 160 kDa, and it also has glycosylation modification.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for COL4A1 antibody 30850-1-AP | Download protocol |
| WB protocol for COL4A1 antibody 30850-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Discov Oncol Hypoxia-mediated HES4 promotes the proliferation and motility of hepatocellular carcinoma cell by enhancing COL4A2 transcription | ||
Cell Signal Hispolon reduces mitochondrial dysfunction and improves fibrosis of diabetes nephropathy by activating AMPK signal and inhibiting mPTP opening | ||
Sci Rep Molecular mechanisms and therapeutic targets in glioblastoma multiforme: network and single-cell analyses | ||
Int Immunopharmacol SIRT5 induces glomerular sclerosis in diabetic nephropathy through p53. | ||
Funct Integr Genomics Epigenetic silencing of MSTN via m6A modification underlies the renoprotective effects of engineered MSC exosomes with RBM15 depletion in diabetic nephropathy. | ||
Sci Rep Yiqi Juanshen decoction alleviates renal interstitial fibrosis by targeting the LOXL2/PI3K/AKT pathway to suppress EMT and inflammation |

