Validation Data Gallery
Tested Applications
| Positive WB detected in | unboiled mouse lung tissue, hTERT-RPE1 cells, rat lung tissue, unboiled rat lung tissue |
| Positive IHC detected in | human colon tissue, mouse lung tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse lung tissue, mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 74 publications below |
| IHC | See 4 publications below |
| IF | See 17 publications below |
Product Information
29767-1-AP targets Claudin 5 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, bovine, sheep |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29044 Product name: Recombinant human CLDN5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 144-218 aa of BC032363 Sequence: VREFYDPSVPVSQKYELGAALYIGWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKNYV 相同性解析による交差性が予測される生物種 |
| Full Name | claudin 5 |
| Calculated molecular weight | 218 aa, 23 kDa |
| Observed molecular weight | 23 kDa |
| GenBank accession number | BC032363 |
| Gene Symbol | CLDN5 |
| Gene ID (NCBI) | 7122 |
| RRID | AB_2935477 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O00501 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Claudins are a family of proteins that are the most important components of the tight junctions, where they establish the paracellular barrier that controls the flow of molecules in the intercellular space between the cells of an epithelium. Claudin-5 is a tight junction protein primarily expressed in endothelial cells, forming the blood-brain barrier. It regulates paracellular permeability and is crucial for vascular integrity. Altered expression is linked to blood-brain barrier disruption in neurological diseases and cancer metastasis.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Claudin 5 antibody 29767-1-AP | Download protocol |
| IHC protocol for Claudin 5 antibody 29767-1-AP | Download protocol |
| WB protocol for Claudin 5 antibody 29767-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Metabolism Setmelanotide alleviates diabetes-associated cognitive impairment by interrupting the binding of ICAM-1 and JIP1 in endothelial cells of the blood-brain barrier. | ||
Redox Biol SLC22A3 deficiency leads to cognitive impairment through the cardio-neuroinflammatory axis mediated HA/H1R/NLRP3 pathway in heart failure mice. | ||
Cardiovasc Diabetol Pgk1 activation restores endothelial metabolic homeostasis to alleviate vascular aging and atherosclerosis. | ||
J Nanobiotechnology Targeting microglial circMBNL1 unlocks a novel nanomedicine therapeutic strategy for major depressive disorder. | ||
J Nanobiotechnology tLyP-1 peptide-modified MnO₂ co-delivering si-SLC16A1 and temozolomide synergistically suppresses glioblastoma via hypoxia modulation and metabolic stress. | ||
Adv Sci (Weinh) USP11-PGAM5 Axis Promotes Neurotoxic Astrocyte Reactivity by Aggravating the mtDNA-cGAS-STING Pathway After Intracerebral Hemorrhage. |