Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse heart tissue, human heart tissue, human uterus tissue, mouse brain tissue, mouse kidney tissue, mouse lung tissue, mouse small intestine tissue, mouse spleen tissue, mouse stomach tissue, PC-3 cells, rat kidney tissue, Transfected HEK-293 cells |
| Positive IHC detected in | human liver cancer tissue, human heart tissue, human liver tissue, human prostate cancer tissue, human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 8 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
Product Information
13317-1-AP targets Cytoglobin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4161 Product name: Recombinant human CYGB protein Source: e coli.-derived, T-HIS Tag: 6*His Domain: 1-190 aa of BC029798 Sequence: MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYASCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP 相同性解析による交差性が予測される生物種 |
| Full Name | cytoglobin |
| Calculated molecular weight | 190 aa, 21 kDa |
| Observed molecular weight | 21-29 kDa |
| GenBank accession number | BC029798 |
| Gene Symbol | Cytoglobin |
| Gene ID (NCBI) | 114757 |
| RRID | AB_2090645 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8WWM9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Cytoglobin, also named as Histoglobin, HGb, STAP and CYGB, belongs to the globin family. Cytoglobin may have a protective function during conditions of oxidative stress. It may be involved in intracellular oxygen storage or transfer. It serves as a defensive mechanism against oxidative stress both in vitro and in vivo.(PMID:21224051) Cytoglobin is a ubiquitously expressed hexacoordinate hemoglobin that may facilitate diffusion of oxygen through tissues. The protein, with calculated MW of 21 kd, runs as a 29kd one in canine retina, kidney, liver, lung, and heart. It may be caused by posttranslational modification of the protein. Various immuno-staining patterns were reported including nuclear, cytoplasm and extracellular location.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Cytoglobin antibody 13317-1-AP | Download protocol |
| IHC protocol for Cytoglobin antibody 13317-1-AP | Download protocol |
| WB protocol for Cytoglobin antibody 13317-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Arterioscler Thromb Vasc Biol The Hemoglobin Homolog Cytoglobin in Smooth Muscle Inhibits Apoptosis and Regulates Vascular Remodeling.
| ||
Antioxid Redox Signal The anti-oxidative role of cytoglobin in podocytes: implications for a role in chronic kidney disease. | ||
Antioxidants (Basel) Cytoglobin Silencing Promotes Melanoma Malignancy but Sensitizes for Ferroptosis and Pyroptosis Therapy Response
| ||
J Cell Physiol Integrative proteomics and immunochemistry analysis of the factors in the necrosis and repair in acetaminophen-induced acute liver injury in mice. | ||
Mol Med Rep Intranasal administration of Cytoglobin modifies human umbilical cord‑derived mesenchymal stem cells and improves hypoxic‑ischemia brain damage in neonatal rats by modulating p38 MAPK signaling‑mediated apoptosis. | ||
Vascul Pharmacol Endothelial cell-induced cytoglobin expression in vascular smooth muscle cells contributes to modulation of nitric oxide. |



























