Validation Data Gallery
Tested Applications
| Positive WB detected in | HepG2 cells, mouse liver tissue, human liver tissue, mouse lung tissue, human adrenal gland tissue, rat liver tissue, rat lung tissue |
| Positive IP detected in | mouse lung tissue |
| Positive IHC detected in | human testis tissue, mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 6 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
Product Information
15469-1-AP targets CYB5B in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7771 Product name: Recombinant human CYB5B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-110 aa of BC004373 Sequence: MATAEASGSDGKGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPS 相同性解析による交差性が予測される生物種 |
| Full Name | cytochrome b5 type B (outer mitochondrial membrane) |
| Calculated molecular weight | 16 kDa |
| Observed molecular weight | 20-21 kDa |
| GenBank accession number | BC004373 |
| Gene Symbol | CYB5B |
| Gene ID (NCBI) | 80777 |
| RRID | AB_2230349 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O43169 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
CYB5B(Cytochrome b5 type B) is also named as CYB5M, OMB5 and belongs to the cytochrome b5 family. It is a 21 kDa membrane bound hemoprotein which function as an electron carrier for several membrane bound oxygenases. This protein is expressed on the plasma membrane of lymphoma cells but not normal lymphocytes, reactive lymphocytes or bone marrow precursor cells(PMID:20100355). The full length protein has a propeptide with 11 amino acids.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CYB5B antibody 15469-1-AP | Download protocol |
| IHC protocol for CYB5B antibody 15469-1-AP | Download protocol |
| IP protocol for CYB5B antibody 15469-1-AP | Download protocol |
| WB protocol for CYB5B antibody 15469-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Chem Biol Physical and Functional Analysis of the Putative Rpn13 Inhibitor RA190.
| ||
PLoS Genet Divergent role of Mitochondrial Amidoxime Reducing Component 1 (MARC1) in human and mouse | ||
Front Mol Biosci Comprehensive Analysis of mTORC1 Signaling Pathway-Related Genes in the Prognosis of HNSCC and the Response to Chemotherapy and Immunotherapy. | ||
J Biol Chem Competition for cysteine acylation by C16:0 and C18:0 derived lipids is a global phenomenon in the proteome | ||
Cell Rep Defects in CYB5A and CYB5B impact sterol-C4 oxidation in cholesterol biosynthesis and demonstrate regulatory roles of dimethyl sterols | ||
Oral Dis Benzylurea Protects hPDLFs Against LPS-Induced Mitochondrial Dysfunction Through MTCH2 |













