Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, Jurkat cells, SH-SY5Y cells, NIH/3T3 cells, Neuro cells, PC-12 cells, mouse testis tissue, rat testis tissue, mouse brain tissue |
| Positive IP detected in | mouse testis tissue, HeLa cells |
| Positive IHC detected in | human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 4 publications below |
| WB | See 19 publications below |
| IHC | See 3 publications below |
| IF | See 3 publications below |
| IP | See 1 publications below |
Product Information
11107-1-AP targets CUL3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1555 Product name: Recombinant human CUL3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 469-768 aa of BC039598 Sequence: KLEGMFRDMSISNTTMDEFRQHLQATGVSLGGVDLTVRVLTTGYWPTQSATPKCNIPPAPRHAFEIFRRFYLAKHSGRQLTLQHHMGSADLNATFYGPVKKEDGSEVGVGGAQVTGSNTRKHILQVSTFQMTILMLFNNREKYTFEEIQQETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIENGHIFTVNDQFTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVAEVTQQLKARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA 相同性解析による交差性が予測される生物種 |
| Full Name | cullin 3 |
| Calculated molecular weight | 89 kDa |
| Observed molecular weight | 80-89 kDa |
| GenBank accession number | BC039598 |
| Gene Symbol | CUL3 |
| Gene ID (NCBI) | 8452 |
| RRID | AB_2086429 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13618 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Cullin-RING-based BCR (BTB-CUL3-RBX1) E3 ligase are the largest family of ubiquitin ligases which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. One of seven cullin proteins serves as a scaffold protein for the assembly of the multisubunit ubiquitin ligase complex. CUL3 (Cullin-3) ubiquitin ligase complex targets multiple substrate for ubiquitination including cyclin E and of cyclin D1. Defects in CUL3 are the cause of Pseudohypoaldosteronism type 2E (PHA2E) characterized by severe hypertension, hyperkalemia, hyperchloremia, hyperchloremic metabolic acidosis, and correction of physiologic abnormalities by thiazide diuretics.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CUL3 antibody 11107-1-AP | Download protocol |
| IHC protocol for CUL3 antibody 11107-1-AP | Download protocol |
| IP protocol for CUL3 antibody 11107-1-AP | Download protocol |
| WB protocol for CUL3 antibody 11107-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Adv Sci (Weinh) DDRGK1 Enhances Osteosarcoma Chemoresistance via Inhibiting KEAP1-Mediated NRF2 Ubiquitination | ||
Free Radic Biol Med β-Sitosterol targets ASS1 for Nrf2 ubiquitin-dependent degradation, inducing ROS-mediated apoptosis via the PTEN/PI3K/AKT signaling pathway in ovarian cancer | ||
Sci Total Environ USP15 participates in DBP-induced testicular oxidative stress injury through regulating the Keap1/Nrf2 signaling pathway. | ||
Food Chem Tangeretin maintains antioxidant activity by reducing CUL3 mediated NRF2 ubiquitination. | ||
Aging (Albany NY) Tumor suppressor DCAF15 inhibits epithelial-mesenchymal transition by targeting ZEB1 for proteasomal degradation in hepatocellular carcinoma.
| ||
FEBS J CUL3 induces mitochondrial dysfunction via MRPL12 ubiquitination in renal tubular epithelial cells |






