Validation Data Gallery
Tested Applications
| Positive WB detected in | HL-60 cells, HeLa cells, NIH/3T3 cells, HT-1080 cells, mouse brain tissue, rat brain tissue |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human breast cancer tissue, human skin cancer tissue, human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 6 publications below |
| IHC | See 1 publications below |
| IP | See 1 publications below |
| CoIP | See 1 publications below |
Product Information
13002-1-AP targets CUGBP1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3677 Product name: Recombinant human CUGBP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 107-479 aa of BC031079 Sequence: DRKLFIGMISKKCTENDIRVMFSSFGQIEECRILRGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQTMEGCSSPMVVKFADTQKDKEQKRMAQQLQQQMQQISAASVWGNLAGLNTLGPQYLALLQQTASSGNLNTLSSLHPMGGLNAMQLQNLAALAAAASAAQNTPSGTNALTTSSSPLSVLTSSAGSSPSSSSSNSVNPIASLGALQTLAGATAGLNVGSLAGMAALNGGLGSSGLSNGTGSTMEALTQAYSGIQQYAAAALPTLYNQNLLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSKND 相同性解析による交差性が予測される生物種 |
| Full Name | CUG triplet repeat, RNA binding protein 1 |
| Calculated molecular weight | 483 aa, 52 kDa |
| Observed molecular weight | 51-55 kDa |
| GenBank accession number | BC031079 |
| Gene Symbol | CUGBP1 |
| Gene ID (NCBI) | 10658 |
| RRID | AB_10642947 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q92879 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
CUG triplet repeat RNA binding protein 1 (CUGBP1) is a member of the CUGBP Elav-like family (CELF), which plays an important role in cardiac development and function (PMID: 17130239). CUGBP1 has also been shown to localize to cytoplasmic stress granules when cells are stressed.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CUGBP1 antibody 13002-1-AP | Download protocol |
| IHC protocol for CUGBP1 antibody 13002-1-AP | Download protocol |
| IP protocol for CUGBP1 antibody 13002-1-AP | Download protocol |
| WB protocol for CUGBP1 antibody 13002-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Hum Mol Genet CGG repeats in RNA modulate expression of TDP-43 in mouse and fly models of fragile X tremor ataxia syndrome. | ||
Carcinogenesis RNA-binding protein CUGBP1 controls the differential INSR splicing in molecular subtypes of breast cancer cells and affects cell aggressiveness.
| ||
Sci Rep DLX6-AS1 activated by H3K4me1 enhanced secondary cisplatin resistance of lung squamous cell carcinoma through modulating miR-181a-5p/miR-382-5p/CELF1 axis.
| ||
Bioengineered Guizhi Fuling pill attenuates liver fibrosis in vitro and in vivo via inhibiting TGF-β1/Smad2/3 and activating IFN-γ/Smad7 signaling pathways. | ||
Life Sci Alliance Endo-bind-n-seq: identifying RNA motifs of RNA binding proteins isolated from endogenous sources | ||
iScience Insulin receptor isoform B is required for efficient proinsulin processing in pancreatic β cells |












