Validation Data Gallery
Tested Applications
| Positive WB detected in | A431 cells, HaCat cells, Raji cells, U-937 cells |
| Positive IHC detected in | mouse lung tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 3 publications below |
| IHC | See 3 publications below |
| IF | See 1 publications below |
Product Information
10315-1-AP targets Cathepsin H in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0361 Product name: Recombinant human CTSH protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 58-289 aa of BC002479 Sequence: FASNWRKINAHNNGNHTFKMALNQFSDMSFAEIKHKYLWSEPQNCSATKSNYLRGTGPYPPSVDWRKKGNFVSPVKNQGACGSCWTFSTTGALESAIAIATGKMLSLAEQQLVDCAQDFNNHGCQGGLPSQAFEYILYNKGIMGEDTYPYQGKDGYCKFQPGKAIGFVKDVANITIYDEEAMVEAVALYNPVSFAFEVTQDFMMYRTGIYSSTSCHKTPDKVNHAVLAVGYG 相同性解析による交差性が予測される生物種 |
| Full Name | cathepsin H |
| Calculated molecular weight | 41 kDa, 28 kDa |
| Observed molecular weight | 28, 41 kDa |
| GenBank accession number | BC002479 |
| Gene Symbol | Cathepsin H |
| Gene ID (NCBI) | 1512 |
| RRID | AB_2087534 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P09668 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Cathepsin H (CTSH, synonyms: CPSB, MGC1519, minichain) is a lysosomal cysteine proteinase important in the overall degradation of lysosomal proteins. It is composed of a dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor. This protein, which belongs to the peptidase C1 protein family, can act both as an aminopeptidase and as an endopeptidase. Increased expression of this gene has been correlated with malignant progression of prostate tumors.Cathepsin H is a unique member of the cysteine cathepsins that acts primarily as an aminopeptidase. Like other cysteine cathepsins, it is synthesized as an inactive precursor and activated by proteolytic removal of its propeptide. In human cells, Cathepsin H exists an autocatalytic form, proceeding from an inactive 41 kDa pro-form, through a 30 kDa intermediate form, to the 28 kDa mature form (PMID: 22704610).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Cathepsin H antibody 10315-1-AP | Download protocol |
| IHC protocol for Cathepsin H antibody 10315-1-AP | Download protocol |
| WB protocol for Cathepsin H antibody 10315-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Rep Med Distinct immune microenvironment of lung adenocarcinoma in never-smokers from smokers | ||
Oncogene Cathepsin H regulated by the thyroid hormone receptors associate with tumor invasion in human hepatoma cells. | ||
Microscopy (Oxf) Histochemical examination on principal collagen fibers in periodontal ligaments of ascorbic acid-deficient ODS-od/od rats. | ||
Front Pediatr Impaired FGF10 Signaling and Epithelial Development in Experimental Lung Hypoplasia With Esophageal Atresia. | ||
J Inflamm Res Identifying and Validating Extracellular Matrix-Related Gene CTSH in Diabetic Foot Ulcer Using Bioinformatics and Machine Learning | ||
NPJ Precis Oncol Integrating bulk, single-cell, and spatial transcriptomics to identify and functionally validate novel targets to enhance immunotherapy in NSCLC |




