Validation Data Gallery
Tested Applications
Positive WB detected in | HEK-293 cells, HeLa cells, HepG2 cells, Raji cells |
Positive IP detected in | HeLa cells |
Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HepG2 cells |
Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:6000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 3 publications below |
WB | See 14 publications below |
IHC | See 2 publications below |
IF | See 12 publications below |
IP | See 1 publications below |
CoIP | See 2 publications below |
Product Information
15914-1-AP targets CTP synthase in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, mouse, zebrafish, mosquito |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag8707 Product name: Recombinant human CTPS protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 242-591 aa of BC009408 Sequence: ICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQPRKMLMKWKEMADRYDRLLETCSIALVGKYTKFSDSYASVIKALEHSALAINHKLEIKYIDSADLEPITSQEEPVRYHEAWQKLCSAHGVLVPGGFGVRGTEGKIQAIAWARNQKKPFLGVCLGMQLAVVEFSRNVLGWQDANSTEFDPTTSHPVVVDMPEHNPGQMGGTMRLGKRRTLFQTKNSVMRKLYGDADYLEERHRHRFEVNPVWKKCLEEQGLKFVGQDVEGERMEIVELEDHPFFVGVQYHPEFLSRPIKPSPPYFGLLLASVGRLSHYLQKGCRLSPRDTYSDRIGSSSPDSEITELKFPSINHD 相同性解析による交差性が予測される生物種 |
Full Name | CTP synthase |
Calculated molecular weight | 591 aa, 67 kDa |
Observed molecular weight | 67 kDa |
GenBank accession number | BC009408 |
Gene Symbol | CTPS |
Gene ID (NCBI) | 1503 |
RRID | AB_2086513 |
Conjugate | Unconjugated |
Form | |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P17812 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
CTP synthase(CTPS) is also named as CTPS1 and belongs to the CTP synthase family. It catalyses the ATP-dependent formation of CTP from UTP using either L-glutamine or NH3 as the nitrogen source(PMID:12752439). It is important in the biosynthesis of phospholipids and nucleic acids, and plays a key role in cell growth, development, and tumorigenesis (PMID:8813694). CTP synthetase exists as a dimer in the absence of its substrates ATP and UTP, but in the presence of saturating concentrations of these substrates the enzyme exists as a tetramer.(PMID:18439916)
Protocols
Product Specific Protocols | |
---|---|
WB protocol for CTP synthase antibody 15914-1-AP | Download protocol |
IHC protocol for CTP synthase antibody 15914-1-AP | Download protocol |
IF protocol for CTP synthase antibody 15914-1-AP | Download protocol |
IP protocol for CTP synthase antibody 15914-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cancer Res Combined inactivation of CTPS1 and ATR is synthetically lethal to MYC-overexpressing cancer cells. | ||
J Cell Physiol Energy deficiency caused by CTPS downregulation in decidua may contribute to pre-eclampsia by impairing decidualization. | ||
Front Immunol Flow Cytometry Contributions for the Diagnosis and Immunopathological Characterization of Primary Immunodeficiency Diseases With Immune Dysregulation. | ||
Oncotarget Identification and validation of differentially expressed proteins in epithelial ovarian cancers using quantitative proteomics. | ||
J Cell Sci Rod and Ring formation from IMP dehydrogenase is regulated via the one-carbon metabolic pathway. |