Validation Data Gallery
Tested Applications
| Positive WB detected in | rat testis tissue, mouse thymus tissue, rat thymus tissue |
| Positive IP detected in | mouse testis tissue |
| Positive IHC detected in | human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
| IHC | See 1 publications below |
| IF | See 5 publications below |
Product Information
12131-1-AP targets CREM in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2775 Product name: Recombinant human CREM protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-137 aa of BC017117 Sequence: MTMETVESQHDGSITASLTESKSAHVQTQTGQNSIPALAQVAAIAETDESAESEGVIDSHKRREILSRRPSYRKILNELSSDVPGVPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQYSMYAAIRYDTVLALSLL 相同性解析による交差性が予測される生物種 |
| Full Name | cAMP responsive element modulator |
| Calculated molecular weight | 332 aa, 36 kDa |
| Observed molecular weight | 36 kDa |
| GenBank accession number | BC017117 |
| Gene Symbol | CREM |
| Gene ID (NCBI) | 1390 |
| RRID | AB_2084260 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q03060 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Cyclic AMP-responsive element modulator (CREM) is a transcription factor highly expressed in the post-meiotic germ cells of the testis. Its pivotal role is to regulate the expression of several germ cell-specific genes, a crucial function as demonstrated by the severe phenotype of mice whose CREM gene was mutated by homologous recombination. CREM-deficient male animals are sterile and display a ten-fold increase in the apoptosis of germ cells. Recent results have shown that CREM needs a tissue-specific co-activator, ACT (activator of CREM in testis) to elicit its regulatory function in testis (PMID: 10824972). Also, CREM is a crucial regulator of NK cell function. CREM exerts its regulatory functions through epigenetic reprogramming of CAR-NK cells (PMID: 40468083).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CREM antibody 12131-1-AP | Download protocol |
| IP protocol for CREM antibody 12131-1-AP | Download protocol |
| WB protocol for CREM antibody 12131-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Biofabrication Testis on a chip - a microfluidic 3-dimensional culture system for the development of spermatogenesisin-vitro. | ||
Int J Mol Sci The Expression Levels and Cellular Localization of Pigment Epithelium Derived Factor (PEDF) in Mouse Testis: Its Possible Involvement in the Differentiation of Spermatogonial Cells. | ||
Int J Mol Sci Effect of Chemotherapy Cytarabine and Acute Myeloid Leukemia on the Development of Spermatogenesis at the Adult Age of Immature Treated Mice. | ||
Int J Mol Sci Effect of Temperature on the Development of Stages of Spermatogenesis and the Functionality of Sertoli Cells In Vitro | ||
Life Sci Adrenocorticotropic hormone and its receptor as a novel testicular system involves in the development of spermatogenesis |




