Validation Data Gallery
Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, HT-29 cells, MCF-7 cells, mouse embryo tissue |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | mouse embryo tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human skin cancer tissue |
| Positive IF/ICC detected in | MCF-7 cells |
| Positive FC (Intra) detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:150-1:600 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 7 publications below |
| WB | See 33 publications below |
| IHC | See 15 publications below |
| IF | See 15 publications below |
| IP | See 4 publications below |
| CoIP | See 2 publications below |
Product Information
10225-1-AP targets CRABP2 in WB, IHC, IF/ICC, IF-P, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0309 Product name: Recombinant human CRABP2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-138 aa of BC001109 Sequence: MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE 相同性解析による交差性が予測される生物種 |
| Full Name | cellular retinoic acid binding protein 2 |
| Calculated molecular weight | 16 kDa |
| Observed molecular weight | 16 kDa |
| GenBank accession number | BC001109 |
| Gene Symbol | CRABP2 |
| Gene ID (NCBI) | 1382 |
| RRID | AB_2085455 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P29373 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Cellular retinoic acid binding protein 2 (CRABP2, synonyms: RBP6, CRABP-II). A number of specific carrier proteins for members of the vitamin A family have been discovered. Cellular retinoic acid binding proteins (CRABP) are low molecular weight proteins whose precise function remains unknown. CRABP2 is important in retinoic acid-mediated regulation of human skin growth and differentiation. It has been postulated that the CRABP2 gene is transcriptionally regulated by a newly synthesized regulatory protein.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CRABP2 antibody 10225-1-AP | Download protocol |
| IHC protocol for CRABP2 antibody 10225-1-AP | Download protocol |
| IP protocol for CRABP2 antibody 10225-1-AP | Download protocol |
| WB protocol for CRABP2 antibody 10225-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Science A single progenitor population switches behavior to maintain and repair esophageal epithelium. | ||
Mol Cell TRIP12 promotes small-molecule-induced degradation through K29/K48-branched ubiquitin chains. | ||
Neuron Divergent Hox Coding and Evasion of Retinoid Signaling Specifies Motor Neurons Innervating Digit Muscles. | ||
Dev Cell Single-Cell Transcriptomic Analyses of the Developing Meninges Reveal Meningeal Fibroblast Diversity and Function. | ||
Proc Natl Acad Sci U S A UTX (KDM6A) promotes differentiation noncatalytically in somatic self-renewing epithelia |







