Validation Data Gallery
Tested Applications
| Positive WB detected in | HEK-293T cells, LNCaP cells, T-47D cells, MCF-7 cells, mouse liver tissue, rat liver tissue |
| Positive IP detected in | mouse liver tissue |
| Positive IHC detected in | mouse heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | C2C12 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:300-1:1200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 56 publications below |
| IHC | See 4 publications below |
| IF | See 2 publications below |
| IP | See 6 publications below |
Product Information
26555-1-AP targets CPT2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, monkey, zebrafish, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24897 Product name: Recombinant human CPT2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 32-178 aa of BC002445 Sequence: GQYLQRSIVPTMHYQDSLPRLPIPKLEDTIRRYLSAQKPLLNDGQFRKTEQFCKSFENGIGKELHEQLVALDKQNKHTSYILGPWFDMYLSARDSVVLNFNPFMAFNPDPKSEYNDQLTRATNMTVSAIRFLKTLRAGLLEPEVFHL 相同性解析による交差性が予測される生物種 |
| Full Name | carnitine palmitoyltransferase 2 |
| Calculated molecular weight | 74 kDa |
| Observed molecular weight | 65-70 kDa |
| GenBank accession number | BC002445 |
| Gene Symbol | CPT2 |
| Gene ID (NCBI) | 1376 |
| RRID | AB_2880551 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P23786 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Carnitine palmitoyltransferase-1 and -2 (CPT1 and CPT2) are two genetically distinct mitochondrial membrane bound enzymes and play critical role in the regulation of FAO in normal cells. CPT2 is an ubiquitous protein and locates in the inner membrane of mitochondrial (PMID: 29437870). CPT2 is frequently down-regulated in primary ovarian serous carcinomas, which is significantly correlated with poor survival of ovarian cancer patients (PMID: 33486313). Down-regulation of CPT2 was a major cause of acylcarnitine accumulation and a common feature in mouse models of obesity- and NASH-driven HCC and human SH-HCC (PMID: 29872321).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CPT2 antibody 26555-1-AP | Download protocol |
| IHC protocol for CPT2 antibody 26555-1-AP | Download protocol |
| IP protocol for CPT2 antibody 26555-1-AP | Download protocol |
| WB protocol for CPT2 antibody 26555-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Metab Targeting Erbin-mitochondria axis in platelets/megakaryocytes promotes B cell-mediated antitumor immunity | ||
Cell Stem Cell A small-molecule cocktail promotes mammalian cardiomyocyte proliferation and heart regeneration. | ||
Nat Commun Hyodeoxycholic acid ameliorates nonalcoholic fatty liver disease by inhibiting RAN-mediated PPARα nucleus-cytoplasm shuttling | ||
Nat Commun Moderate-intensity interval exercise exacerbates cardiac lipotoxicity in high-fat, high-calories diet-fed mice | ||
Cell Death Differ NAT10 regulates heart development and function by maintaining the expression of genes related to fatty acid β-oxidation and heart contraction | ||







