Recombinant human CPO protein
Source
e coli.-derived, PET28a
Tag
6*His
Format
Liquid
Cat no : Ag24120
Synonyms
MGC138281; MGC138283
Validation Data Gallery View All
Product Information
| Peptide Sequence |
YDRSLAQHRQEIVDKSVSPWSLETYSYNIYHPMGEIYEWMREISEKYKEVVTQHFLGVTYETHPIYYLKISQPSGNPKKII
(21-101 aa encoded by BC112078) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |


