Recombinant human COX7A2L protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag1980
Synonyms
COX7AR; COX7RP; EB1; SIG81
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVYLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK
(1-114 aa encoded by BC007095) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |


