Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse skeletal muscle tissue, mouse cartilage tissue, rat cartilage tissue, pig cartilage tissue |
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 4 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
| ChIP | See 1 publications below |
Product Information
28369-1-AP targets COMP in WB, IHC, IF/ICC, FC (Intra), ChIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag28749 Product name: Recombinant human COMP protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 35-257 aa of BC033676 Sequence: LRELQETNAALQDVRELLRQQVREITFLKNTVMECDACGMQQSVRTGLPSVRPLLHCAPGFCFPGVACIQTESGARCGPCPAGFTGNGSHCTDVNECNAHPCFPRVRCINTSPGFRCEACPPGYSGPTHQGVGLAFAKANKQVCTDINECETGQHNCVPNSVCINTRGSFQCGPCQPGFVGDQASGCQRRAQRFCPDGSPSECHEHADCVLERDGSRSCVCAV 相同性解析による交差性が予測される生物種 |
| Full Name | cartilage oligomeric matrix protein |
| Calculated molecular weight | 757 aa, 83 kDa |
| Observed molecular weight | 80-110 kDa |
| GenBank accession number | BC033676 |
| Gene Symbol | COMP |
| Gene ID (NCBI) | 1311 |
| RRID | AB_2881126 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P49747 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
COMP is a secreted pentameric glycoprotein built from modular units and belongs to the thrombospondin protein family. COMP is expressed by hypertrophic chondrocytes and osteoblasts during endochondral ossification, and its expression is increased during fracture healing. COMP is involved in the assembly of collagen fibrils and other structural matrix components. COMP interacts with a number of cartilage ECM proteins, including fibronectin, collagen I, II IX, XII, and XIV, matrilins, as well as proteoglycans such as aggrecan and others.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for COMP antibody 28369-1-AP | Download protocol |
| IHC protocol for COMP antibody 28369-1-AP | Download protocol |
| WB protocol for COMP antibody 28369-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Int J Chron Obstruct Pulmon Dis Identification of Hub Genes Associated with COPD Through Integrated Bioinformatics Analysis. | ||
J Gastroenterol Enhanced COMP expression induced by Helicobacter pylori drives gastric cancer progression by NOTCH2/SMAD3 pathway. | ||
Eur J Pharmacol Endonuclear Circ-calm4 Regulates Ferroptosis via a circR-Loop of the COMP Gene in Pulmonary Artery Smooth Muscle Cells | ||
Cartilage Exosomal LINC01106 From PRP-Treated ADSCs Alleviates Chondrocyte Inflammatory Injury by Sponging miR-34a-5p to Upregulate SIRT1 Expression. | ||
Front Mol Biosci Serum proteomic profiling of precancerous gastric lesions and early gastric cancer reveals signatures associated with systemic inflammatory response and metaplastic differentiation | ||
Reprod Sci Effect of GLIS1 on the Lymph Node Metastasis of Cervical Squamous Carcinoma Based on Transcriptome Analysis |





