Validation Data Gallery
Tested Applications
| Positive WB detected in | HEK-293 cells, human brain tissue, Jurkat cells, K-562 cells |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human prostate cancer tissue, human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 8 publications below |
| IHC | See 1 publications below |
| IF | See 16 publications below |
| CoIP | See 2 publications below |
Product Information
10967-1-AP targets Coilin in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1416 Product name: Recombinant human COIL protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 212-576 aa of BC010385 Sequence: ANQRCSSPKGSARNSLVKAKRKGSVSVCSKESPSSSSESESCDESISDGPSKVTLEARNSSEKLPTELSKEEPSTKNTTADKLAIKLGFSLTPSKGKTSGTTSSSSDSSAESDDQCLMSSSTPECAAGFLKTVGLFAGRGRPGPGLSSQTAGAAGWRRSGSNGGGQAPGASPSVSLPASLGRGWGREENLFSWKGAKGRGMRGRGRGRGHPVSCVVNRSTDNQRQQQLNDVVKNSSTIIQNPVETPKKDYSLLPLLAAAPQVGEKIAFKLLELTSSYSPDVSDYKEGRILSHNPETQQVDIEILSSLPALREPGKFDLVYHNENGAEVVEYAVTQESKITVFWKELIDPRLIIESPSNTSSTEPA 相同性解析による交差性が予測される生物種 |
| Full Name | coilin |
| Calculated molecular weight | 576 aa, 63 kDa |
| Observed molecular weight | 80 kDa |
| GenBank accession number | BC010385 |
| Gene Symbol | COIL |
| Gene ID (NCBI) | 8161 |
| RRID | AB_2276345 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P38432 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
The nuclear coiled body(CBs) and nuclear structures known as gems contain high concentrations of the survival motor neurons (SMN) protein complex. CBs and gems often colocalize, and communication between them is mediated by COIL. COIL is a component of the CBS which are involved in the function or assembly/disassembly of nucleoplasmic snRNPs. During mitosis, CBs disassemble, coinciding with a mitotic-specific phosphorylation of p80 coilin, and symmetrical dimethylation of the COIL RG box motif is a molecular switch that determines whether the SMN complex forms gems or becomes incorporated into CBs
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Coilin antibody 10967-1-AP | Download protocol |
| IF protocol for Coilin antibody 10967-1-AP | Download protocol |
| IHC protocol for Coilin antibody 10967-1-AP | Download protocol |
| IP protocol for Coilin antibody 10967-1-AP | Download protocol |
| WB protocol for Coilin antibody 10967-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nucleic Acids Res mRNAs are sorted for export or degradation before passing through nuclear speckles. | ||
Clin Transl Med HSF4/COIL complex-dependent R-loop mediates ultraviolet-induced inflammatory skin injury | ||
Elife Characterisation of the biflavonoid hinokiflavone as a pre-mRNA splicing modulator that inhibits SENP. | ||
Biomolecules Mutations of Key Functional Residues in CRM1/XPO1 Differently Alter Its Intranuclear Localization and the Nuclear Export of Endogenous Cargos | ||
Neurobiol Dis UsnRNP trafficking is regulated by stress granules and compromised by mutant ALS proteins. |







