Validation Data Gallery
Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, PC-3 cells |
| Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 22 publications below |
| IHC | See 3 publications below |
| IF | See 3 publications below |
Product Information
18094-1-AP targets CLOCK in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12826 Product name: Recombinant human CLOCK protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC041878 Sequence: MLFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSMLPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFISNEEFTQLMLEALDGFFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSLTPEYLKSKNQLEFCCHMLRGTIDPKEPSTYEYVKFIGNFKSLNSVSSSAHNGFEGTIQRTHRPSYEDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWL 相同性解析による交差性が予測される生物種 |
| Full Name | clock homolog (mouse) |
| Calculated molecular weight | 846 aa, 95 kDa |
| Observed molecular weight | 95-110 kDa |
| GenBank accession number | BC041878 |
| Gene Symbol | CLOCK |
| Gene ID (NCBI) | 9575 |
| RRID | AB_2878497 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O15516 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Circadian locomoter output cycles protein kaput (CLOCK), also named as BHLHE8 or KIAA0334, is a 846 amino acid protein, which contains one bHLH domain, one PAC domain, and two PAS domains. CLOCK localizes in the nucleus and cytoplasm. CLOCK) is expressed in all tissues examined including spleen, thymus, prostate, testis, ovary, small intestine, colon, leukocytes, heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. ARNTL/2-CLOCK heterodimers activate E-box element (5'-CACGTG-3') transcription of a number of proteins of the circadian clock, such as PER1 and PER2. The calculated molecular weight of CLOCK is 95kDa, we detected a 95-110 kDa protein by western blot. Our result is similar to the result of reseach paper (PMID: 30683868).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CLOCK antibody 18094-1-AP | Download protocol |
| IHC protocol for CLOCK antibody 18094-1-AP | Download protocol |
| IP protocol for CLOCK antibody 18094-1-AP | Download protocol |
| WB protocol for CLOCK antibody 18094-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Sci Total Environ Metastatic effects of perfluorooctanoic acid (PFOA) on Drosophila melanogaster with metabolic reprogramming and dysrhythmia in a multigenerational exposure scenario | ||
Int J Mol Sci Piperine Improves Lipid Dysregulation by Modulating Circadian Genes Bmal1 and Clock in HepG2 Cells.
| ||
J Agric Food Chem 3-MCPD Induced Mitochondrial Damage of Renal Cells Via the Rhythmic Protein BMAL1 Targeting SIRT3/SOD2 | ||
Neoplasia A long noncoding RNA perturbs the circadian rhythm of hepatoma cells to facilitate hepatocarcinogenesis. | ||
J Agric Food Chem Capsaicin Attenuates Oleic Acid-Induced Lipid Accumulation via the Regulation of Circadian Clock Genes in HepG2 Cells. |







