Validation Data Gallery
Tested Applications
| Positive WB detected in | JAR cells, human placenta tissue, mouse kidney tissue, rat kidney tissue |
| Positive IHC detected in | human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 6 publications below |
| IHC | See 1 publications below |
| IF | See 3 publications below |
| CoIP | See 1 publications below |
Product Information
15971-1-AP targets CLIC3 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8757 Product name: Recombinant human CLIC3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-236 aa of BC007012 Sequence: MAETKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRSPDVLKDFAPGSQLPILLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRALARLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAMQEKEFKYTCPHSAEILAAYRPAVHPR 相同性解析による交差性が予測される生物種 |
| Full Name | chloride intracellular channel 3 |
| Calculated molecular weight | 236 aa, 26 kDa |
| Observed molecular weight | 27-30 kDa |
| GenBank accession number | BC007012 |
| Gene Symbol | CLIC3 |
| Gene ID (NCBI) | 9022 |
| RRID | AB_2229648 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O95833 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume (PMID: 9880541). CLIC3 (chloride intracellular channel protein 3) belongs to the chloride channel CLIC family which has seven members based on sequence homology to the p64 chloride channels of bovine kidney microsomes. CLIC proteins lack the membrane-spanning domains characteristic of channel proteins and are largely intracellular. CLIC3 is predominantly localized in the nucleus and has a high expression level in placenta (PMID: 9880541; 17027078). It associates with the C-terminal of ERK7 and may participate in cellular growth control.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CLIC3 antibody 15971-1-AP | Download protocol |
| IHC protocol for CLIC3 antibody 15971-1-AP | Download protocol |
| WB protocol for CLIC3 antibody 15971-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
PLoS One Mechanisms that determine the internal environment of the developing brain: a transcriptomic, functional and ultrastructural approach. | ||
J Cancer Analysis of Differentially Expressed Genes in a Chinese Cohort of Esophageal Squamous Cell Carcinoma. | ||
Front Cell Neurosci Identification of immune-related biomarkers in peripheral blood of schizophrenia using bioinformatic methods and machine learning algorithms | ||
Discov Oncol Single-cell transcriptomics identify a chemotherapy-resistance related cluster overexpressed CLIC3 in ovarian cancer
| ||
Invest Ophthalmol Vis Sci Expression Distribution of Keratins in Normal and Pathological Corneas and the Regulatory Role of Krt17 on Limbal Stem Cells | ||
Biophys J Biophysical characterization of anion channels in Mitochondrion-Endoplasmic-Reticulum Contact sites (MERCs) |





