Validation Data Gallery
Tested Applications
| Positive WB detected in | HL-60 cells, HeLa cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | mouse colon tissue, human colon tissue, human pancreas tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells, HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 6 publications below |
| IHC | See 4 publications below |
| IF | See 2 publications below |
Product Information
14545-1-AP targets CLIC1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6049 Product name: Recombinant human CLIC1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-241 aa of BC064527 Sequence: MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK 相同性解析による交差性が予測される生物種 |
| Full Name | chloride intracellular channel 1 |
| Calculated molecular weight | 27 kDa |
| Observed molecular weight | 27-32 kDa |
| GenBank accession number | BC064527 |
| Gene Symbol | CLIC1 |
| Gene ID (NCBI) | 1192 |
| RRID | AB_2081809 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O00299 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Chloride intracellular channel protein 1 (CLIC1) is a member of the chloride intracellular channel protein family. It plays a crucial role in various cellular processes, including the regulation of chloride ion transport, cell viability, and mitochondrial function. CLIC1 is involved in the formation of membrane-inserted channels that facilitate chloride ion movement, which is essential for maintaining cellular homeostasis and function (PMID: 32116799). Additionally, CLIC1 has been implicated in cancer progression, where it influences cell proliferation, migration, and invasion (PMID: 38027011).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CLIC1 antibody 14545-1-AP | Download protocol |
| IHC protocol for CLIC1 antibody 14545-1-AP | Download protocol |
| IP protocol for CLIC1 antibody 14545-1-AP | Download protocol |
| WB protocol for CLIC1 antibody 14545-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun CLICs-dependent chloride efflux is an essential and proximal upstream event for NLRP3 inflammasome activation. | ||
Alzheimers Res Ther Circular RNA APP contributes to Alzheimer's disease pathogenesis by modulating microglial polarization via miR-1906/CLIC1 axis | ||
Oxid Med Cell Longev Attenuation of ROS/Chloride Efflux-Mediated NLRP3 Inflammasome Activation Contributes to Alleviation of Diabetic Cardiomyopathy in Rats after Sleeve Gastrectomy. | ||
Transl Oncol Chloride intracellular channel 1 promotes esophageal squamous cell carcinoma proliferation via mTOR signalling
| ||
Cell Biochem Biophys CLIC1 Inhibition Protects Against Cellular Senescence and Endothelial Dysfunction Via the Nrf2/HO-1 Pathway. | ||
Anticancer Res Chloride Intracellular Channel 1 Expression Is Associated With Poor Prognosis of Lung Adenocarcinoma. |










