Validation Data Gallery
Tested Applications
| Positive WB detected in | human liver tissue, mouse liver tissue |
| Positive IP detected in | mouse liver tissue |
| Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 6 publications below |
Product Information
11553-1-AP targets CHRNB1 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2108 Product name: Recombinant human CHRNB1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 151-501 aa of BC023553 Sequence: CSIQVTYFPFDWQNCTMVFSSYSYDSSEVSLQTGLGPDGQGHQEIHIHEGTFIENGQWEIIHKPSRLIQPPGDPRGGREGQRQEVIFYLIIRRKPLFYLVNVIAPCILITLLAIFVFYLPPDAGEKMGLSIFALLTLTVFLLLLADKVPETSLSVPIIIKYLMFTMVLVTFSVILSVVVLNLHHRSPHTHQMPLWVRQIFIHKLPLYLRLKRPKPERDLMPEPPHCSSPGSGWGRGTDEYFIRKPPSDFLFPKPNRFQPELSAPDLRRFIDGPNRAVALLPELREVVSSISYIARQLQEQEDHDALKEDWQFVAMVVDRLFLWTFIIFTSVGTLVIFLDATYHLPPPDPFP 相同性解析による交差性が予測される生物種 |
| Full Name | cholinergic receptor, nicotinic, beta 1 (muscle) |
| Calculated molecular weight | 501 aa, 57 kDa |
| Observed molecular weight | 50-57 kDa |
| GenBank accession number | BC023553 |
| Gene Symbol | CHRNB1 |
| Gene ID (NCBI) | 1140 |
| RRID | AB_2291854 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P11230 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Acetylcholine receptors (AChRs) are integral membrane proteins that respond to the binding of acetylcholine (ACh), a neurotransmitter synthesized, stored and finally released by cholinergic neurons. After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. The muscle acetylcholine receptor is composed of five subunits: two alpha subunits and one each of the beta, delta, and gamma (in immature muscle) or epsilon (in mature muscle) subunits. CHRNB1 gene encodes acetylcholine receptor subunit beta (ACHRB). Mutations in this gene are associated with slow-channel congenital myasthenic syndrome.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CHRNB1 antibody 11553-1-AP | Download protocol |
| IP protocol for CHRNB1 antibody 11553-1-AP | Download protocol |
| WB protocol for CHRNB1 antibody 11553-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Aging (Albany NY) Maternal high sugar and fat diet benefits offspring brain function via targeting on the gut-brain axis. | ||
Aging (Albany NY) A five-m6A regulatory gene signature is a prognostic biomarker in lung adenocarcinoma patients. | ||
Transl Psychiatry A diet high in sugar and fat influences neurotransmitter metabolism and then affects brain function by altering the gut microbiota. | ||
Genes Immun Plasticity of the murine spleen T-cell cholinergic receptors and their role in in vitro differentiation of na?ve CD4 T cells toward the Th1, Th2 and Th17 lineages. | ||
Biochem Biophys Res Commun Association of a newly identified lncRNA LNC_000280 with the formation of acetylcholine receptor clusters in vitro. | ||
Mol Ther Nucleic Acids MiR-142a-3p: A novel ACh receptor transcriptional regulator in association with peripheral nerve injury |



