Validation Data Gallery
Tested Applications
| Positive WB detected in | NIH/3T3 cells, mouse brain tissue, RAW 264.7 cells |
| Positive IHC detected in | human pancreas tissue, mouse pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse colon tissue |
| Positive IF-Fro detected in | mouse colon tissue |
| Positive FC (Intra) detected in | PC-12 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)-FRO | IF-FRO : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 6 publications below |
| IHC | See 1 publications below |
| IF | See 2 publications below |
Product Information
14968-1-AP targets Chromogranin B in WB, IHC, IF-P, IF-Fro, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6833 Product name: Recombinant human CHGB protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 328-677 aa of BC000375 Sequence: HSTHYRASEEEPEYGEEIKGYPGVQAPEDLEWERYRGRGSEEYRAPRPQSEESWDEEDKRNYPSLELDKMAHGYGEESEEERGLEPGKGRHHRGRGGEPRAYFMSDTREEKRFLGEGHHRVQENQMDKARRHPQGAWKELDRNYLNYGEEGAPGKWQQQGDLQDTKENREEARFQDKQYSSHHTAEKRKRLGELFNPYYDPLQWKSSHFERRDNMNDNFLEGEEENELTLNEKNFFPEYNYDWWEKKPFSEDVNWGYEKRNLARVPKLDLKRQYDRVAQLDQLLHYRKKSAEFPDFYDSEEPVSTHQEAENEKDRADQTVLTEDEKKELENLAAMDLELQKIAEKFSQRG 相同性解析による交差性が予測される生物種 |
| Full Name | chromogranin B (secretogranin 1) |
| Calculated molecular weight | 78 kDa |
| Observed molecular weight | 70-100 kDa |
| GenBank accession number | BC000375 |
| Gene Symbol | Chromogranin B |
| Gene ID (NCBI) | 1114 |
| RRID | AB_2081138 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P05060 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Chromogranin B is also named as Secretogranin-1, SgI, CgB, CHGB and SCG1. CHGB, a secretory granule protein, inserts itself into membrane and forms a chloride-conducting channel (PMID: 30456382). Native CHGB distributes nearly equally in soluble and membrane-bound forms, and both reconstitute highly selective anion channels in membrane (PMID: 37435575). The calculated molecular weight of Chromogranin B is at 78kDa. It has been shown that CHGB has a clear degradation band at ~50 kDa (https://www.biorxiv.org/content/10.1101/2019.12.28.890053v1.full.pdf).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Chromogranin B antibody 14968-1-AP | Download protocol |
| IF protocol for Chromogranin B antibody 14968-1-AP | Download protocol |
| IHC protocol for Chromogranin B antibody 14968-1-AP | Download protocol |
| WB protocol for Chromogranin B antibody 14968-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Adv Sci (Weinh) Identification of PRDX5 as A Target for The Treatment of Castration-Resistant Prostate Cancer | ||
J Virol Kaposi's Sarcoma-Associated Herpesvirus Infection Induces the Expression of Neuroendocrine Genes in Endothelial Cells. | ||
J Proteome Res Label-Free LC-MS/MS Proteomic Analysis of Cerebrospinal Fluid Identifies Protein/Pathway Alterations and Candidate Biomarkers for Amyotrophic Lateral Sclerosis. | ||
Biosci Biotechnol Biochem Identification of proteins that bind to the neuroprotective agent neoechinulin A.
| ||
mBio Citrobacter rodentium Infection Induces Persistent Molecular Changes and Interferon Gamma-Dependent Major Histocompatibility Complex Class II Expression in the Colonic Epithelium. |











