Validation Data Gallery
Tested Applications
| Positive WB detected in | Caco-2 cells, mouse colon tissue, COLO 320 cells |
| Positive IHC detected in | rat colon tissue, human colon cancer tissue, human rectal cancer tissue, mouse colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | Caco-2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:5000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
| IHC | See 4 publications below |
| IF | See 1 publications below |
Product Information
82659-1-RR targets CDX2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag17310 Product name: Recombinant human CDX2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-180 aa of BC014461 Sequence: MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGLNGGSPAAAMGYSSPADYHPHHHPHHHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGGQRRNLCEWMRKPAQQSLGSQ 相同性解析による交差性が予測される生物種 |
| Full Name | caudal type homeobox 2 |
| Calculated molecular weight | 313 aa, 34 kDa |
| Observed molecular weight | 33-40 kDa |
| GenBank accession number | BC014461 |
| Gene Symbol | CDX2 |
| Gene ID (NCBI) | 1045 |
| RRID | AB_3086497 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q99626 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
CDX2, also named as Homeobox protein CDX-2, is a 313 amino acid protein, which contains one homeobox DNA-binding domain and belongs to the Caudal homeobox family. CDX2 localizes in the nucleus and is involved in the transcriptional regulation of multiple genes expression in the intestinal epithelium. The relative expression of CDX1 to CDX2 protein may be important in the anterior to posterior patterning of the intestinal epithelium and in defining patterns of proliferation and differentiation along the crypt-villus axis. Both Cdx1 and Cdx2 genes must be expressed to reduce tumorigenic potential, to increase sensitivity to apoptosis, and to reduce cell migration, suggesting that the two genes control the normal phenotype by independent pathways.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CDX2 antibody 82659-1-RR | Download protocol |
| IHC protocol for CDX2 antibody 82659-1-RR | Download protocol |
| WB protocol for CDX2 antibody 82659-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Transl Oncol L-theanine's therapeutic effects on colorectal cancer: Mechanistic insights from a 1,2-dimethylhydrazine-induced rat model. | ||
Phytomedicine Huo Po Xia Ling decoction exerts preventive and improvement effects on gastric precancerous lesions by remodeling gut microbiota and associated metabolites. | ||
Chin Med Weiyan Tongluo Granules attenuate gastric intestinal metaplasia through PPARγ/NF-κB/CDX2 signaling pathway. | ||
Biofabrication 3D bioprinting platform development for high-throughput cancer organoid models construction and drug evaluation | ||
Exp Ther Med Appendiceal mucinous tumour resulting in autoamputation of the appendix: A case report and literature review. | ||
Phytomedicine JianPi QingRe HuoXue Formula targets Cadherin-17 to induce apoptosis in chronic atrophic gastritis with intestinal metaplasia. |


















