Validation Data Gallery
Tested Applications
| Positive WB detected in | HL-60 cells, HeLa cells, K-562 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human cervical cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HepG2 cells, HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 4 publications below |
| IF | See 3 publications below |
Product Information
22060-1-AP targets CDK2 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17133 Product name: Recombinant human CDK2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 217-298 aa of BC003065 Sequence: RTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL 相同性解析による交差性が予測される生物種 |
| Full Name | cyclin-dependent kinase 2 |
| Calculated molecular weight | 298 aa, 34 kDa |
| Observed molecular weight | 30 kDa |
| GenBank accession number | BC003065 |
| Gene Symbol | CDK2 |
| Gene ID (NCBI) | 1017 |
| RRID | AB_2878982 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P24941 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
CDK2(Cyclin-dependent kinase 2) is also named as CDKN2 and belongs to the protein kinase superfamily. It is dispensable for myelination but is important for adult oligodendrocyte progenitor cell renewal, and could be one of the underlying mechanisms that drive adult progenitors to differentiate and thus regenerate myelin(PMID:21502361). G2 phase CCNA1/CDK2 controls the timing of entry into mitosis by controlling the subsequent activation of CCNB/CDK1, but also has an unexpected role in coordinating the activation of CCNB/CDK1 at the centrosome and in the nucleus(PMID:18372919). It has 2 isoforms produced by alternative splicing with the molecular weight of 34 kDa and 30 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CDK2 antibody 22060-1-AP | Download protocol |
| IF protocol for CDK2 antibody 22060-1-AP | Download protocol |
| IHC protocol for CDK2 antibody 22060-1-AP | Download protocol |
| IP protocol for CDK2 antibody 22060-1-AP | Download protocol |
| WB protocol for CDK2 antibody 22060-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Elife Centriolar satellites assemble centrosomal microcephaly proteins to recruit CDK2 and promote centriole duplication. | ||
Biomark Res Long noncoding RNA HOXC-AS3 interacts with CDK2 to promote proliferation in hepatocellular carcinoma | ||
Eur J Pharmacol Hypericin-mediated photodynamic therapy inhibits growth of colorectal cancer cells via inducing S phase cell cycle arrest and apoptosis. | ||
Front Pharmacol Methamphetamine exposure drives cell cycle exit and aberrant differentiation in rat hippocampal-derived neurospheres | ||
Am J Cancer Res E2F1-mediated GINS2 transcriptional activation promotes tumor progression through PI3K/AKT/mTOR pathway in hepatocellular carcinoma | ||
Neoplasia FAM111B enhances glycolysis and promotes metastasis of prostate cancer by upregulating LDHA |








