Validation Data Gallery
Tested Applications
| Positive WB detected in | HEK-293T cells, HeLa cells, Jurkat cells, MDA-MB-468 cells |
| Positive IHC detected in | human ovary cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | K-562 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 7 publications below |
Product Information
30461-1-AP targets CDK13 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag32897 Product name: Recombinant human CDK13 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1150-1300 aa of NM_003718.4 Sequence: QESSKPLGGIQPSSQTIQPKVETDAAQAAVQSAFAVLLTQLIKAQQSKQKDVLLEERENGSGHEASLQLRPPPEPSTPVSGQDDLIQHQDMRILELTPEPDRPRILPPDQRPPEPPEPPPVTEEDLDYRTENQHVPTTSSSLTDPHAGVKA 相同性解析による交差性が予測される生物種 |
| Full Name | cell division cycle 2-like 5 (cholinesterase-related cell division controller) |
| Calculated molecular weight | 165 kDa |
| Observed molecular weight | 170 kDa |
| GenBank accession number | NM_003718.4 |
| Gene Symbol | CDK13 |
| Gene ID (NCBI) | 8621 |
| RRID | AB_3086325 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q14004 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Cyclin-dependent kinase 13 (CDK13) is also named as CDC2L, CDC2L5, CHED and KIAA1791, and belongs to the CMGC Ser/Thr protein kinase family. Interestingly, in TNBC cells silencing CDK13 provokes cell death without affecting DDR genes. Like CDK12, CDK13 phosphorylates the Ser2 position of the heptad repeat in the CTD of RNA Pol II (PMID:26748711). CDK13/CycK complex is that regulates transcription by phosphorylating serine residues at positions 5 and 2 of the heptapeptide repeats (Y-S-P-T-S-P-S) comprising the C-terminal domain (CTD) of RPB1, the largest subunit of RNA polymerase II (RNAPII). CDK13 is expressed in fetal brain, liver, and muscle, and adult whole brain, hippocampus, and bone marrow (PMID:30904094).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CDK13 antibody 30461-1-AP | Download protocol |
| IF protocol for CDK13 antibody 30461-1-AP | Download protocol |
| IHC protocol for CDK13 antibody 30461-1-AP | Download protocol |
| WB protocol for CDK13 antibody 30461-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Carcinogenesis CDK12 is a promising therapeutic target for the transcription cycle and DNA damage response in metastatic osteosarcoma | ||
J Med Chem Translational Research on the Oral Delivery of the Cytotoxic PROTAC Molecule via Tumor-Targeting Prodrug Strategy for Triple-Negative Breast Cancer Treatment | ||
Cell Signal Targeting CDK12 rescues C/EBPβ-mediated platinum and PARP inhibitor resistance in ovarian cancer. | ||
J Clin Invest CDK12/13 inactivation triggers STING-mediated antitumor immunity in preclinical models.
| ||
Eur J Med Chem Novel E-F ring derivatives of aconitine scaffold as potent Hsp90 inhibitors for the treatment of colorectal cancer | ||
J Biol Chem Phosphorylation of RBM39 by CDK13 stabilizes RAD50 mRNA to drive cisplatin resistance in endometrial cancer.
|



