Validation Data Gallery
Tested Applications
| Positive WB detected in | rat brain tissue |
| Positive IP detected in | rat brain tissue |
| Positive IHC detected in | rat brain tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 5 publications below |
| IHC | See 3 publications below |
Product Information
12958-1-AP targets RASGRF1 in WB, IHC, IP, ELISA applications and shows reactivity with mouse, rat samples.
| Tested Reactivity | mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4072 Product name: Recombinant human RASGRF1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 832-1181 aa of BC040275 Sequence: QSDDGDTETSPTKSPTTPKSVKNKNSSEFPLFSYNNGVVMTSCRELDNNRSALSAASAFAIATAGANEGTPNKEKYRRMSLASAGFPPDQRNGDKEFVIRRAATNRVLNVLRHWVSKHSQDFETNDELKCKVIGFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDNQITLEEITQMAEGVKAEPFENHSALEIAEQLTLLDHLVFKKIPYEEFFGQGWMKLEKNERTPYIMKTTKHFNDISNLIASEIIRNEDINARVSAIEKWVAVADICRCLHNYNAVLEITSSMNRSAIFRLKKTWLKVSKQVRAGGWHHCLPGAGLGLGQEDPWAGHWASTSGQRTGLRSNTPR 相同性解析による交差性が予測される生物種 |
| Full Name | Ras protein-specific guanine nucleotide-releasing factor 1 |
| Calculated molecular weight | 134 kDa |
| Observed molecular weight | 130-140 kDa |
| GenBank accession number | BC040275 |
| Gene Symbol | RASGRF1 |
| Gene ID (NCBI) | 5923 |
| RRID | AB_2238126 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13972 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
RasGRF1, a member of calmodulin-activated guanine-nucleotide exchange factors (GEFs), highly expressed at the synaptic junctions of the central nervous system (CNS). It is similar to the Saccharomyces cerevisiae CDC25. RASGRF1 serves as an in vivo activator for H-RAS and members of the R-RAS and RAC subfamilies. Several studies have shown that RasGRF1 also binds to microtubules and participate in the regulation of neurite outgrowth. RasGRF1 has been implicated in neuronal excitability. The studies of the similar gene in mouse suggested that the Ras-GEF activity of this protein in brain can be activated by Ca2+ influx, muscarinic receptors, and G protein beta-gamma subunit. Mouse studies also indicated that the Ras-GEF signaling pathway mediated by this protein may be important for long-term memory.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for RASGRF1 antibody 12958-1-AP | Download protocol |
| IP protocol for RASGRF1 antibody 12958-1-AP | Download protocol |
| WB protocol for RASGRF1 antibody 12958-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Aging (Albany NY) Upregulation of RasGRF1 ameliorates spatial cognitive dysfunction in mice after chronic cerebral hypoperfusion
| ||
J Agric Food Chem Anthocyanins from Black Chokeberry (Aroniamelanocarpa Elliot) Delayed Aging-Related Degenerative Changes of Brain. | ||
Leuk Lymphoma Amplification of B cell receptor-Erk signaling by Rasgrf-1 over-expression in chronic lymphocytic leukemia. | ||
Biomaterials LDH nanoparticles-doped cellulose nanofiber scaffolds with aligned microchannels direct high-efficiency neural regeneration and organized neural circuit remodeling through RhoA/Rock/Myosin II pathway | ||
Cell Biol Toxicol FTO-mediated the destabilization of RASGRF1 mRNA impedes thyroid cancer progression and suppresses macrophage M2 polarization | ||
Bone Res IGF2BP3-mediated m6A modification of RASGRF1 promoting joint injury in rheumatoid arthritis
|



