Validation Data Gallery
Tested Applications
| Positive WB detected in | HCT 116 cells, HEK-293 cells, HeLa cells, L02 cells, HEK-293-derived exosomes |
| Positive IHC detected in | human lung cancer tissue, human breast cancer tissue, human endometrial cancer tissue, human ovary cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human ovary cancer tissue |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 458 publications below |
| IHC | See 7 publications below |
| IF | See 6 publications below |
| IP | See 1 publications below |
| ELISA | See 1 publications below |
| FC | See 1 publications below |
Product Information
20597-1-AP targets CD9 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat, rabbit, monkey, chicken, zebrafish, sheep, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14546 Product name: Recombinant human CD9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 100-208 aa of BC011988 Sequence: FAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMI 相同性解析による交差性が予測される生物種 |
| Full Name | CD9 molecule |
| Calculated molecular weight | 228 aa, 25 kDa |
| Observed molecular weight | 23-30 kDa |
| GenBank accession number | BC011988 |
| Gene Symbol | CD9 |
| Gene ID (NCBI) | 928 |
| RRID | AB_2878706 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P21926 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
The cell-surface molecule CD9, a member of the transmembrane-4 superfamily, interacts with the integrin family and other membrane proteins, and is postulated to participate in cell migration and adhesion. Expression of CD9 enhances membrane fusion between muscle cells and promotes viral infection in some cells (PMID:10459022). It is often used as a mesenchymal stem cell marker (PMID:18005405). The CD9 antigen appears to be a 227-amino acid molecule with four hydrophobic domains and one N-glycosylation site (PMID: 1840589). This antibody detects bands of 23-30 kDa, it may be due to the difference of glycosylations (PMID: 8701996).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CD9 antibody 20597-1-AP | Download protocol |
| IHC protocol for CD9 antibody 20597-1-AP | Download protocol |
| WB protocol for CD9 antibody 20597-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Circulating tumor cells shielded with extracellular vesicle-derived CD45 evade T cell attack to enable metastasis | ||
Gastroenterology PTEN deficiency facilitates exosome secretion and metastasis in cholangiocarcinoma by impairing TFEB-mediated lysosome biogenesis | ||
Bioact Mater Profibrogenic macrophage-targeted delivery of mitochondrial protector via exosome formula for alleviating pulmonary fibrosis | ||
Nat Commun Injectable ECM-mimetic dynamic hydrogels abolish ferroptosis-induced post-discectomy herniation through delivering nucleus pulposus progenitor cell-derived exosomes | ||
J Extracell Vesicles Quantification of urinary podocyte-derived migrasomes for the diagnosis of kidney disease |











