Validation Data Gallery
Tested Applications
| Positive WB detected in | Raji cells, Daudi cells |
| Positive IHC detected in | human tonsillitis tissue, human lymphoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human tonsillitis tissue |
| Positive IF/ICC detected in | Ramos cells, Raji cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:2500-1:10000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
| IHC | See 1 publications below |
Product Information
66965-1-Ig targets CD40 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag28040 Product name: Recombinant human CD40 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 24-193 aa of BC012419 Sequence: TACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR 相同性解析による交差性が予測される生物種 |
| Full Name | CD40 molecule, TNF receptor superfamily member 5 |
| Calculated molecular weight | 277 aa, 31 kDa |
| Observed molecular weight | 43 kDa |
| GenBank accession number | BC012419 |
| Gene Symbol | CD40 |
| Gene ID (NCBI) | 958 |
| ENSEMBL Gene ID | ENSG00000101017 |
| RRID | AB_2882288 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P25942 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Cluster of differentiation 40 (CD40) is a costimulatory protein located on antigen presenting cells and is required for their activation. CD40 is a member of the tumor necrosis factor (TNF) receptor (TNFR) family.
What is the molecular weight of CD40?
The molecular weight of CD40 is 43 kDa.
What is the cellular localization of CD40?
CD40 can be secreted by cells or found in the cell membrane.
What is the tissue specificity of CD40?
CD40 is expressed in B cells and primary carcinoma cells but is also found in dendritic cells and macrophages (PMID: 10209159).
What is the function of CD40?
CD40 acts as a receptor for TNFSF5/CD40LG, which is expressed on activated T cells. This interaction is essential for B cell proliferation, expression of activation markers, immunoglobulin production, and isotype switching (PMID: 8809473). This interaction is also crucial for the formation of memory B cells and germinal centers, and signaling through CD40 prevents apoptosis of germinal center B cells.
What is the role of CD40 in disease?
Defects in CD40 lead to hyper-IgM immunodeficiency syndrome type 3 (HIGM3) (PMID: 11675497). This is an autosomal recessive disorder that includes the inability of B cells to undergo isotype switching, a key step in the final differentiation of the humoral immune response, and an inability to mount an antibody-specific immune response.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CD40 antibody 66965-1-Ig | Download protocol |
| IHC protocol for CD40 antibody 66965-1-Ig | Download protocol |
| WB protocol for CD40 antibody 66965-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Clin Transl Hepatol A Prognostic Nomogram for Hepatocellular Carcinoma Based on Wound Healing and Immune Checkpoint Genes | ||
Int J Mol Sci Exosomal CD40, CD25, and Serum CA19-9 as Combinatory Novel Liquid Biopsy Biomarker for the Diagnosis and Prognosis of Patients with Pancreatic Ductal Adenocarcinoma | ||
Ann Transl Med Comprehensive analysis of immune-related genes associated with the microenvironment of patients with unexplained infertility |









