Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, K-562 cells, MCF-7 cells |
| Positive IP detected in | K-562 cells |
| Positive IHC detected in | human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:14000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 6 publications below |
| IF | See 1 publications below |
Product Information
12250-1-AP targets Calpastatin in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2897 Product name: Recombinant human CAST protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC013579 Sequence: MNPTETKAVKTEPEKKSQSTKPKSLPKQASDTGSNDAHNKKAVSRSAEQQPSEKSTEPKTKPQDMISAGGESVAGITAISGKPGDKKKEKKSLTPAVPVESKPDKPSGKSGMDAALDDLIDTLGGPEETEEENTTYTGPEVSDPMSSTYIEELGKREVTIPPKYRELLAKKEGITGPPADSSKPIGPDDAIDALSSDFTCGSPTAAGKKTEKEESTEVLKAQSAGTVRSAAPPQEKKRKVEKDTMSDQALEALSASLGTRQAEPELDLRSIKEVDEAKAKEEKLEKCGEDDETIPSEYRLKPATDKDGKPLLPEPEEKPKPRSESELIDELSEDFDRSECKEKPSKPTEK 相同性解析による交差性が予測される生物種 |
| Full Name | calpastatin |
| Calculated molecular weight | 667 aa, 72 kDa |
| Observed molecular weight | 110 kDa |
| GenBank accession number | BC013579 |
| Gene Symbol | Calpastatin |
| Gene ID (NCBI) | 831 |
| RRID | AB_2071702 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P20810 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Calpastatin (CAST) is an endogenous protein that specifically inhibits the activity of calpains, a family of calcium-dependent proteases involved in numerous cellular processes. The CAST gene encodes calpastatin, which contains multiple calpain-inhibiting domains that bind to the active site of calpain, preventing it from performing its functions. Calpastatin is found in the cytosol and plays a key role in regulating intracellular proteolysis, with malfunctions in the calpain-calpastatin system linked to various diseases, including autoimmune disorders and neurodegenerative conditions.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Calpastatin antibody 12250-1-AP | Download protocol |
| IF protocol for Calpastatin antibody 12250-1-AP | Download protocol |
| IHC protocol for Calpastatin antibody 12250-1-AP | Download protocol |
| IP protocol for Calpastatin antibody 12250-1-AP | Download protocol |
| WB protocol for Calpastatin antibody 12250-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Proteome Res Quantitative Proteomic Analysis Reveals that Transmissible Gastroenteritis Virus (TGEV) Activates JAK-STAT1 Signaling Pathway. | ||
Biomedicines Asiatic Acid Prevents Cognitive Deficits by Inhibiting Calpain Activation and Preserving Synaptic and Mitochondrial Function in Rats with Kainic Acid-Induced Seizure. | ||
Ann Anat Calpain2 but not calpain1 mediated by calpastatin following glutamate-induced regulated necrosis in rat retinal neurons. | ||
Oncotarget Decreased calpain activity in chronic myeloid leukemia impairs apoptosis by increasing survivin in myeloid progenitors and xiap1 in differentiating granulocytes. | ||
PeerJ Post-infarction KLHL40-mediated regulation of cardiac sarcomeric integrity and function. | ||
PLoS One Identification of autophagy-related key biomarkers in caerulein induced acute pancreatitis: In silico and in vivo study. |








