Validation Data Gallery
Tested Applications
| Positive WB detected in | Jurkat cells, HEK-293 cells, NIH/3T3 cells, HepG2 cells, HeLa cells |
| Positive IHC detected in | human breast cancer tissue, mouse liver tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:150-1:600 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 388 publications below |
| IHC | See 36 publications below |
| IF | See 31 publications below |
Product Information
66470-2-Ig targets Caspase 3/P17/P19 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, pig, canine, chicken, plant |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25029 Product name: Recombinant human CASP3 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 31-176 aa of BC016926 Sequence: ISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDS 相同性解析による交差性が予測される生物種 |
| Full Name | caspase 3, apoptosis-related cysteine peptidase |
| Calculated molecular weight | 277 aa, 32 kDa |
| Observed molecular weight | 32-35 kDa, 19 kDa, 17 kDa |
| GenBank accession number | BC016926 |
| Gene Symbol | Caspase 3 |
| Gene ID (NCBI) | 836 |
| RRID | AB_2876892 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P42574 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Caspases, a family of endoproteases, are critical players in cell regulatory networks controlling inflammation and cell death. Initiator caspases (caspase-2, -8, -9, -10, -11, and -12) cleave and activate downstream effector caspases (caspase-3, -6, and -7), which in turn execute apoptosis by cleaving targeted cellular proteins. Caspase 3 (also named CPP32, SCA-1, and Apopain) proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at the beginning of apoptosis. Caspase 3 plays a key role in the activation of sterol regulatory element binding proteins (SREBPs) between the basic helix-loop-helix leucine zipper domain and the membrane attachment domain. Caspase 3 can also form heterocomplex with other proteins and performs the molecular mass of 50-70 kDa. This antibody can recognize p17, p19 and p32 of Caspase 3.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Caspase 3/P17/P19 antibody 66470-2-Ig | Download protocol |
| IHC protocol for Caspase 3/P17/P19 antibody 66470-2-Ig | Download protocol |
| WB protocol for Caspase 3/P17/P19 antibody 66470-2-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Adv Sci (Weinh) Mitochondrial tRNAGlu 14693A>G Mutation, an "Enhancer" to the Phenotypic Expression of Leber's Hereditary Optic Neuropathy | ||
Acta Pharm Sin B Protocatechuic aldehyde protects cardiomycoytes against ischemic injury via regulation of nuclear pyruvate kinase M2. | ||
Biomaterials Drug-device-field integration for mitochondria-targeting dysfunction and tumor therapy by home-tailored pyroelectric nanocomposites | ||
Small Inherent Capability of Self-Assembling Nanostructures in Specific Proteasome Activation for Cancer Cell Pyroptosis | ||
Nat Commun BNC1 deficiency-triggered ferroptosis through the NF2-YAP pathway induces primary ovarian insufficiency | ||
Acta Biomater Sodium alginate/collagen/stromal cell-derived factor-1 neural scaffold loaded with BMSCs promotes neurological function recovery after traumatic brain injury. |














