Validation Data Gallery
Tested Applications
| Positive WB detected in | HL-60 cells, A549 cells, mouse brain tissue, COLO 320 cells, NIH/3T3 cells, human skeletal muscle tissue, rat brain tissue, HeLa cells, HepG2 cells, MCF-7 cells, SH-SY5Y cells |
| Positive IHC detected in | human thyroid tissue, human normal colon, human skeletal muscle tissue, human thyroid cancer tissue, mouse colon tissue, mouse lung tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive FC (Intra) detected in | Jurkat cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 5 publications below |
| WB | See 58 publications below |
| IHC | See 20 publications below |
| ELISA | See 1 publications below |
| CoIP | See 2 publications below |
Product Information
10292-1-AP targets calreticulin in WB, IHC, FC (Intra), CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0325 Product name: Recombinant human calreticulin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-200 aa of BC002500 Sequence: MLLSVPLLLGLLGLAVAEPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDW 相同性解析による交差性が予測される生物種 |
| Full Name | calreticulin |
| Calculated molecular weight | 60 kDa |
| Observed molecular weight | 55 kDa |
| GenBank accession number | BC002500 |
| Gene Symbol | Calreticulin |
| Gene ID (NCBI) | 811 |
| RRID | AB_2069615 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P27797 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
CALR,also named as grp60, ERp60, HACBP, CRP55, CRTC and Calregulin, belongs to the calreticulin family. It is a molecular calcium-binding chaperone promoting folding, oligomeric assembly and quality control in the ER via the calreticulin/calnexin cycle. CALR is a ER marker. It interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. CALR interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export. The MW of CALR migrates aberrantly at 55 kDa by SDS-PAGE. Some study provided that it's a new possibility for CRT-mediated tumor immune prevention and treatment.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for calreticulin antibody 10292-1-AP | Download protocol |
| IHC protocol for calreticulin antibody 10292-1-AP | Download protocol |
| WB protocol for calreticulin antibody 10292-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
ACS Nano Nanointegrative In Situ Reprogramming of Tumor-Intrinsic Lipid Droplet Biogenesis for Low-Dose Radiation-Activated Ferroptosis Immunotherapy | ||
ACS Nano Starting the Engine and Releasing the Brakes of T-Cell Responses: A Biomimetic Dendritic Cell Nanoplatform for Improved Glioblastoma Immunotherapy | ||
ACS Nano An Implantable Double-Layered Spherical Scaffold Depositing Gene and Cell Agents to Facilitate Collaborative Cancer Immunotherapy | ||
Cell Res DNA damage triggers tubular endoplasmic reticulum extension to promote apoptosis by facilitating ER-mitochondria signaling. | ||
Adv Sci (Weinh) Mitigating Doxorubicin-Induced Cardiotoxicity and Enhancing Anti-Tumor Efficacy with a Metformin-Integrated Self-Assembled Nanomedicine |





















