Recombinant human C1QB protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag10225
Synonyms
Validation Data Gallery View All
Product Information
| Peptide Sequence |
LIDISQAQLSCTGPPAIPGIPGIPGTPGPDGQPGTPGIKGEKGLPGLAGDHGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAPGAPGPKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPDMEA
(21-253 aa encoded by BC008983) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |

