Validation Data Gallery
Tested Applications
| Positive WB detected in | A549 cells, mouse pancreas tissue, mouse lung tissue, Jurkat cells |
| Positive IP detected in | Jurkat cells |
| Positive IHC detected in | human breast cancer tissue, human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | Jurkat cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 9 publications below |
| IHC | See 4 publications below |
| IF | See 2 publications below |
Product Information
19848-1-AP targets C14orf166 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13900 Product name: Recombinant human CLE; C14orf166 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-244 aa of BC001722 Sequence: MFRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCPFKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAEPLINLDVNNPDFKAGVMALANLLQIQRHDDYLVMLKAIRILVQERLTQDAVAKANQTKEGLPVALDKHILGFDTGDAVLNEAAQILRLLHIEELRELQTKINEAIVAVQAIIADPKTDHRLGKVGR 相同性解析による交差性が予測される生物種 |
| Full Name | chromosome 14 open reading frame 166 |
| Calculated molecular weight | 244 aa, 28 kDa |
| Observed molecular weight | 28 kDa |
| GenBank accession number | BC001722 |
| Gene Symbol | C14orf166 |
| Gene ID (NCBI) | 51637 |
| RRID | AB_10646485 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y224 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Human CLE/C14orf166 protein is a positive modulator of cellular RNA polymerase. CLE is also shown to interact with the influenza virus polymerase complex and colocalizes with viral ribonucleoproteins, and is required for viral replication. Similarly, CLE is identified as a novel host interacting partners of the mature hepatitis C virus core protein. CLE levels were significantly higher in the serum of patients with PaCa compared with the control group was strongly expressed in tumor cells, suggesting that C14orf166 may be a potential biomarker of pancreatic adenocarcinoma.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for C14orf166 antibody 19848-1-AP | Download protocol |
| IHC protocol for C14orf166 antibody 19848-1-AP | Download protocol |
| IP protocol for C14orf166 antibody 19848-1-AP | Download protocol |
| WB protocol for C14orf166 antibody 19848-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Adv Sci (Weinh) Primate-Specific DAZ Regulates Translation of Cell Proliferation-Related mRNAs and is Essential for Maintenance of Spermatogonia | ||
Nucleic Acids Res A novel all-in-one conditional knockout system uncovered an essential role of DDX1 in ribosomal RNA processing. | ||
Biosci Rep Overexpressed C14orf166 associates with disease progression and poor prognosis in non-small cell lung cancer. | ||
J Transl Med C14orf166 overexpression correlates with tumor progression and poor prognosis of breast cancer.
| ||
Tumour Biol C14ORF166 overexpression is associated with pelvic lymph node metastasis and poor prognosis in uterine cervical cancer. | ||
Tumour Biol Overexpression of chromosome 14 open reading frame 166 correlates with disease progression and poorer prognosis in human NPC. |









